Recombinant Mouse Milk Fat Globule 1 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-9961P
Recombinant Mouse Milk Fat Globule 1 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-9961P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q3TDU5 |
Synonym | BA46 Breast epithelial antigen BA46 EDIL1 HMFG hP47 HsT19888 Lactadherin Medin MFG-E8 MFGE8 MFGM MFGM_HUMAN Milk fat globule EGF factor 8 Milk fat globule EGF factor 8 protein Milk fat globule-EGF factor 8 O acetyl disialoganglioside synthase OAcGD3S SED1 SPAG10 Sperm associated antigen 10 Sperm surface protein hP47 |
Description | Recombinant Mouse Milk Fat Globule 1 Protein (His tag) was expressed in Baculovirus infected insect cells. It is a Full length protein |
Source | Baculovirus infected insect cells |
AA Sequence | ADLASGDFCDSSLCLNGGTCLTGQDNDIYCLCPEGFTGLVCNETERGPCS PNPCYNDAKCLVTLDTQRGDIFTEYICQCPVGYSGIHCETGCSTQLGMEG GAIADSQISASSVYMGFMGLQRWGPELARLYRTGIVNAWTASNYDSKPWI QVNLLRKMRVSGVMTQGASRAGRAEYLKTFKVAYSLDGRKFEFIQDESGG DKEFLGNLDNNSLKVNMFNPTLEAQYIKLYPVSCHRGCTLRFELLGCELH GCSEPLGLKNNTIPDSQMSASSSYKTWNLRAFGWYPHLGRLDNQGKINAW TAQSNSAKEWLQVDLGTQRQVTGIITQGARDFGHIQYVASYKVAHSDDGV QWTVYEEQGSSKVFQGNLDNNSHKKNIFEKPFMARYVRVLPVSWHNRITL RLELLGCHHHHHH |
Molecular Weight | 46 kDa including tags |
Purity | >90% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. |