Recombinant Mouse Mast Cell Tryptase Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-9953P
Recombinant Mouse Mast Cell Tryptase Protein (His tag)

Recombinant Mouse Mast Cell Tryptase Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-9953P
Catalog No.: BLA-9953P

Product Overview

Host Species Mouse
Accession Q02844
Synonym alpha II Lung tryptase Mast cell alpha II tryptase Mast cell beta I tryptase Mast cell protease 7 Mast cell protease II MCP 7 Pituitary tryptase Skin tryptase TPS 1 TPS1 TPS2 TPSAB1 TPSAB1 protein TPSB1 Tryptase 1 Tryptase alpha 1 tryptase alpha I included Tryptase alpha II tryptase alpha II included tryptase alpha included tryptase alpha/beta 1 Tryptase beta 1 tryptase beta I included Tryptase I tryptase I included Tryptase III Tryptase skin
Description Recombinant Mouse Mast Cell Tryptase Protein (His tag) was expressed in E.coli. It is a Protein fragment
Source E.coli
AA Sequence AHGNKWPWQVSLRANDTYWMHFCGGSLIHPQWVLTAAHCVGPDVADPNKV RVQLRKQYLYYHDHLMTVSQIITHPDFYIVQDGADIALLKLTNPVNISDY VHPVPLPPASETFPSGTLCWVTGWGNIDNGVNLPPPFPLKEVQVPIIENH LCDLKYHKGLITGDNVHIVRDDMLCAGNEGHDSCQGDSGGPLVCKVEDTW LQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHH
Molecular Weight 30 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C. Avoid freeze / thaw cycle.
Recently viewed