Recombinant Mouse Mast Cell Tryptase Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-9953P

Recombinant Mouse Mast Cell Tryptase Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-9953P
Catalog No.: BLA-9953P
Product Overview
Host Species | Mouse |
Accession | Q02844 |
Synonym | alpha II Lung tryptase Mast cell alpha II tryptase Mast cell beta I tryptase Mast cell protease 7 Mast cell protease II MCP 7 Pituitary tryptase Skin tryptase TPS 1 TPS1 TPS2 TPSAB1 TPSAB1 protein TPSB1 Tryptase 1 Tryptase alpha 1 tryptase alpha I included Tryptase alpha II tryptase alpha II included tryptase alpha included tryptase alpha/beta 1 Tryptase beta 1 tryptase beta I included Tryptase I tryptase I included Tryptase III Tryptase skin |
Description | Recombinant Mouse Mast Cell Tryptase Protein (His tag) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | AHGNKWPWQVSLRANDTYWMHFCGGSLIHPQWVLTAAHCVGPDVADPNKV RVQLRKQYLYYHDHLMTVSQIITHPDFYIVQDGADIALLKLTNPVNISDY VHPVPLPPASETFPSGTLCWVTGWGNIDNGVNLPPPFPLKEVQVPIIENH LCDLKYHKGLITGDNVHIVRDDMLCAGNEGHDSCQGDSGGPLVCKVEDTW LQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHH |
Molecular Weight | 30 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C. Avoid freeze / thaw cycle. |