Recombinant Mouse MAFK Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-9950P

Recombinant Mouse MAFK Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-9950P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species Mouse
Accession Q61827
Synonym Erythroid transcription factor NF E2 p18 subunit Erythroid transcription factor NF-E2 p18 subunit FLJ32205 MAFK MAFK_HUMAN MGC71717 Nfe2u P18 Transcription factor MafK V maf musculoaponeurotic fibrosarcoma oncogene homolog K (avian)
Description Recombinant Mouse MAFK Protein (Tagged) was expressed in Mammalian. It is a Full length protein
Source Mammalian
AA Sequence MTTNPKPNKALKVKKEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVT RLKQRRRTLKNRGYAASCRIKRVTQKEELERQRVELQQEVEKLARENSSM RLELDALRSKYEALQTFARTVARGPVTPTKVATTSVITIVKSAELSSTSV PFSAAS
Molecular Weight 22 kDa including tags
Purity >85% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function Since they lack a putative transactivation domain, the small Mafs behave as transcriptional repressors when they dimerize among themselves. However, they act as transcriptional activators by dimerizing with other (usually larger) basic-zipper proteins, such as NFE2, NFE2L1/NRF1, NFE2L2/NRF2 and NFE2L3/NRF3, and recruiting them to specific DNA-binding sites. Small Maf proteins heterodimerize with Fos and may act as competitive repressors of the NF-E2 transcription factor.
Subcellular Location Nucleus.
Protein Families BZIP family, Maf subfamily
Database References
Tissue Specificity Highly expressed in heart, skeletal muscle and placenta. Also expressed in erythroid cells.

Gene Functions References

  1. beta-Cell-Specific Mafk Overexpression Impairs Pancreatic Endocrine Cell Development PMID: 26901059
  2. KAP-1 may contribute to the repression of Ey and beta-major globin gene transcription through recruitment to the promoters of these two genes, mediated by the interaction of KAP-1 with either Zfp445 or MafK, respectively PMID: 23291531
  3. regulation of dynamic exchange with Bach1 PMID: 14747657
  4. mafG::mafK::mafF triple-mutant fibroblasts that completely lack small Mafs are highly susceptible to oxidative stress. (mafK) PMID: 16135796
  5. DNA-binding activity of endogenous MafA was significantly increased in the MafK transgenic mice PMID: 16780794
  6. The involvement of both HNF4alpha and NF-E2 in Abcc6 gene regulation suggests that Abcc6 might be involved in a detoxification processes related to hemoglobin or heme. PMID: 16997394
  7. MafK/NF-E2 p18 recruitment was involved in the physical proximity of LCR and active beta-globin genes upon beta-globin gene transcriptional activation. PMID: 18308612
  8. Histological analysis revealed that embryonic development of beta cells in the MafA(-/-)MafK(+) mice was significantly suppressed and the reduced number of beta cells was responsible for the early onset of diabetes. PMID: 19715672

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed