Name: Recombinant Mouse MAFK Protein (Tagged)
Brand: Beta LifeScience
SKU: BLA-9950P
Availability: InStock

Catalog No.: BLA-9950P

Host Species	Mouse
Accession	Q61827
Synonym	Erythroid transcription factor NF E2 p18 subunit Erythroid transcription factor NF-E2 p18 subunit FLJ32205 MAFK MAFK_HUMAN MGC71717 Nfe2u P18 Transcription factor MafK V maf musculoaponeurotic fibrosarcoma oncogene homolog K (avian)
Description	Recombinant Mouse MAFK Protein (Tagged) was expressed in Mammalian. It is a Full length protein
Source	Mammalian
AA Sequence	MTTNPKPNKALKVKKEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVT RLKQRRRTLKNRGYAASCRIKRVTQKEELERQRVELQQEVEKLARENSSM RLELDALRSKYEALQTFARTVARGPVTPTKVATTSVITIVKSAELSSTSV PFSAAS
Molecular Weight	22 kDa including tags
Purity	>85% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.