Recombinant Mouse LYVE1 Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-9949P
Recombinant Mouse LYVE1 Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-9949P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q8BHC0 |
Synonym | Cell surface retention sequence-binding protein 1 CRSBP 1 CRSBP-1 CRSBP1 extracellular link domain containing 1 extracellular link domain-containing 1 Extracellular link domain-containing protein 1 HAR Hyaluronic acid receptor Lymphatic endothelium specific hyaluronan receptor lymphatic vessel endothelial hyaluronan receptor 1 Lymphatic vessel endothelial hyaluronic acid receptor 1 LYVE 1 LYVE-1 LYVE1 LYVE1_HUMAN XLKD1 |
Description | Recombinant Mouse LYVE1 Protein (Fc Tag) was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | ADLVQDLSISTCRIMGVALVGRNKNPQMNFTEANEACKMLGLTLASRDQV ESAQKSGFETCSYGWVGEQFSVIPRIFSNPRCGKNGKGVLIWNAPSSQKF KAYCHNSSDTWVNSCIPEIVTTFYPVLDTQTPATEFSVSSSAYLASSPDS TTPVSATTRAPPLTSMARKTKKICITEVYTEPITMATETEAFVASGAAFK NEAAG |
Molecular Weight | 35 kDa |
Purity | >= 98% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle. |