Recombinant Mouse Ly6g Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-9946P
Recombinant Mouse Ly6g Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-9946P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P35461 |
Synonym | Gr-1 Gr1 Ly-6G.1 Ly6G Lymphocyte antigen 6 complex locus G Lymphocyte antigen 6G |
Description | Recombinant Mouse Ly6g Protein (His tag) was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLP ICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAG |
Molecular Weight | 26 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Subcellular Location | Cell membrane; Lipid-anchor, GPI-anchor. |
Database References | STRING: 10090.ENSMUSP00000023246 |
Tissue Specificity | Expressed in bone marrow. |