Recombinant Mouse Ly6g Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-9946P
Recombinant Mouse Ly6g Protein (His tag)

Recombinant Mouse Ly6g Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-9946P
Catalog No.: BLA-9946P

Product Overview

Host Species Mouse
Accession P35461
Synonym Gr-1 Gr1 Ly-6G.1 Ly6G Lymphocyte antigen 6 complex locus G Lymphocyte antigen 6G
Description Recombinant Mouse Ly6g Protein (His tag) was expressed in Yeast. It is a Full length protein
Source Yeast
AA Sequence LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLP ICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAG
Molecular Weight 26 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
More from Beta LifeScience
More from Other Recombinant Proteins
Recombinant Human TSHR Protein (His Tag)
- Baculovirus-Insect Cells - His - Human - Other Recombinant Proteins - TSHR

Online Inquiry
Recombinant Human PTH1R Protein (His Tag)
- HEK293 - His - Human - Other Recombinant Proteins - PTH1R

Online Inquiry
Recombinant Human PTH / Parathyroid Hormone Protein (Fc Tag)
- Fc - HEK293 - Human - Other Recombinant Proteins - Parathyroid Hormone - PTH

Online Inquiry
Recombinant Human FSH Beta Protein (His Tag)
- FSH Beta - HEK293 - His - Human - Other Recombinant Proteins

Online Inquiry
Recombinant Human FSH Beta Protein (Fc Tag)
- Fc - FSH Beta - HEK293 - Human - Other Recombinant Proteins

Online Inquiry
Recombinant Human CGA & FSHB Heterodimer Protein (Fc Tag)
- CGA & FSHB Heterodimer - Fc - HEK293 - Human - Other Recombinant Proteins

Online Inquiry
Recently viewed