Recombinant Mouse LXN/TCI Protein
Beta LifeScience
SKU/CAT #: BLA-9942P
Recombinant Mouse LXN/TCI Protein
Beta LifeScience
SKU/CAT #: BLA-9942P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P70202 |
Synonym | ECI Endogenous carboxypeptidase inhibitor Latexin Latexin protein LXN LXN_HUMAN MUM Protein MUM TCI Tissue carboxypeptidase inhibitor |
Description | Recombinant Mouse LXN/TCI Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSMEIPPTHYAASRAASVAENCINYQQGT PHKLFLVQTVQQASKEDIPGRGHKYHLKFSVEEIIQKQVTVNCTAEVLYP QMGQGSAPEVNFTFEGEIGKNPDEEDNTFYQSLMSLKRPLEAQDIPDNFG NVSPQMKPVQHLAWVACGYVMWQNSTEDTWYKMLKIQTVKQVQRNDDFIE LDYTILLHDIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEGQAE |
Molecular Weight | 28 kDa including tags |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |