Recombinant Mouse LXN/TCI Protein

Beta LifeScience SKU/CAT #: BLA-9942P
Recombinant Mouse LXN/TCI Protein

Recombinant Mouse LXN/TCI Protein

Beta LifeScience SKU/CAT #: BLA-9942P
Catalog No.: BLA-9942P

Product Overview

Host Species Mouse
Accession P70202
Synonym ECI Endogenous carboxypeptidase inhibitor Latexin Latexin protein LXN LXN_HUMAN MUM Protein MUM TCI Tissue carboxypeptidase inhibitor
Description Recombinant Mouse LXN/TCI Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMGSMEIPPTHYAASRAASVAENCINYQQGT PHKLFLVQTVQQASKEDIPGRGHKYHLKFSVEEIIQKQVTVNCTAEVLYP QMGQGSAPEVNFTFEGEIGKNPDEEDNTFYQSLMSLKRPLEAQDIPDNFG NVSPQMKPVQHLAWVACGYVMWQNSTEDTWYKMLKIQTVKQVQRNDDFIE LDYTILLHDIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEGQAE
Molecular Weight 28 kDa including tags
Purity >95% purity as determined by SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed