Recombinant Mouse Estrogen Inducible Protein pS2

Beta LifeScience SKU/CAT #: BLA-3381P
Recombinant Mouse Estrogen Inducible Protein pS2

Recombinant Mouse Estrogen Inducible Protein pS2

Beta LifeScience SKU/CAT #: BLA-3381P
Catalog No.: BLA-3381P

Product Overview

Host Species Mouse
Accession Q08423
Synonym BCEI Breast cancer estrogen inducible protein Breast cancer estrogen inducible sequence Breast cancer estrogen-inducible protein D21S21 Gastrointestinal trefoil protein Gastrointestinal trefoil protein pS2 hP1.A HP1A HPS 2 HPS2 pNR 2 PNR-2 pNR2 Polypeptide P1.A Protein pS2 PS 2 pS2 pS2 protein TFF 1 TFF1 TFF1_HUMAN Trefoil factor 1
Description Recombinant Mouse Estrogen Inducible Protein pS2 was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence QAQAQAQAQEETCIMAPRERINCGFPGVTAQQCTERGCCFDDSVRGFPWC FHPMAIENTQEEECPF
Molecular Weight 7 kDa
Purity >98% SDS-PAGE.>98 % by HPLC analysis.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed