Recombinant Mouse Estrogen Inducible Protein pS2
Beta LifeScience
SKU/CAT #: BLA-3381P
Recombinant Mouse Estrogen Inducible Protein pS2
Beta LifeScience
SKU/CAT #: BLA-3381P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q08423 |
Synonym | BCEI Breast cancer estrogen inducible protein Breast cancer estrogen inducible sequence Breast cancer estrogen-inducible protein D21S21 Gastrointestinal trefoil protein Gastrointestinal trefoil protein pS2 hP1.A HP1A HPS 2 HPS2 pNR 2 PNR-2 pNR2 Polypeptide P1.A Protein pS2 PS 2 pS2 pS2 protein TFF 1 TFF1 TFF1_HUMAN Trefoil factor 1 |
Description | Recombinant Mouse Estrogen Inducible Protein pS2 was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | QAQAQAQAQEETCIMAPRERINCGFPGVTAQQCTERGCCFDDSVRGFPWC FHPMAIENTQEEECPF |
Molecular Weight | 7 kDa |
Purity | >98% SDS-PAGE.>98 % by HPLC analysis. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |