Recombinant Mouse Aldehyde Dehydrogenase 1A1 (ALDH1A1) Protein (His)

Name: Recombinant Mouse Aldehyde Dehydrogenase 1A1 (ALDH1A1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-04683P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Aldehyde Dehydrogenase 1A1 (ALDH1A1) Protein (His) is produced by our Yeast expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P24549
Target Symbol	ALDH1A1
Synonyms	Aldh1a1; Ahd-2; Ahd2; Aldh1Retinal dehydrogenase 1; RALDH 1; RalDH1; EC 1.2.1.-; EC 1.2.1.36; ALDH-E1; ALHDII; Aldehyde dehydrogenase family 1 member A1; Aldehyde dehydrogenase; cytosolic
Species	Mus musculus (Mouse)
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	SSPAQPAVPAPLADLKIQHTKIFINNEWHNSVSGKKFPVLNPATEEVICHVEEGDKADVDKAVKAARQAFQIGSPWRTMDASERGRLLNKLADLMERDRLLLATMEALNGGKVFANAYLSDLGGCIKALKYCAGWADKIHGQTIPSDGDIFTYTRREPIGVCGQIIPWNFPMLMFIWKIGPALSCGNTVVVKPAEQTPLTALHLASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDVDKVAFTGSTQVGKLIKEAAGKSNLKRVTLELGGKSPCIVFADADLDIAVEFAHHGVFYHQGQCCVAASRIFVEESVYDEFVKRSVERAKKYVLGNPLTPGINQGPQIDKEQHDKILDLIESGKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSVDDVIKRANNTTYGLAAGLFTKDLDKAITVSSALQAGVVWVNCYMMLSAQCPFGGFKMSGNGRELGEHGLYEYTELKTVAMKISQKNS
Expression Range	2-501aa
Protein Length	Full Length of Mature Protein
Mol. Weight	56.3kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Cytosolic dehydrogenase that catalyzes the irreversible oxidation of a wide range of aldehydes to their corresponding carboxylic acid. Functions downstream of retinol dehydrogenases and catalyzes the oxidation of retinaldehyde into retinoic acid, the second step in the oxidation of retinol/vitamin A into retinoic acid. This pathway is crucial to control the levels of retinol and retinoic acid, two important molecules which excess can be teratogenic and cytotoxic (Probable). Also oxidizes aldehydes resulting from lipid peroxidation like (E)-4-hydroxynon-2-enal/HNE, malonaldehyde and hexanal that form protein adducts and are highly cytotoxic. By participating for instance to the clearance of (E)-4-hydroxynon-2-enal/HNE in the lens epithelium prevents the formation of HNE-protein adducts and lens opacification. Functions also downstream of fructosamine-3-kinase in the fructosamine degradation pathway by catalyzing the oxidation of 3-deoxyglucosone, the carbohydrate product of fructosamine 3-phosphate decomposition, which is itself a potent glycating agent that may react with lysine and arginine side-chains of proteins. Has also an aminobutyraldehyde dehydrogenase activity and is probably part of an alternative pathway for the biosynthesis of GABA/4-aminobutanoate in midbrain, thereby playing a role in GABAergic synaptic transmission.
Subcellular Location	Cytoplasm, cytosol. Cell projection, axon.
Protein Families	Aldehyde dehydrogenase family
Database References	KEGG: mmu:11668 STRING: 10090.ENSMUSP00000084918 UniGene: PMID: 28117896 In ovaries lacking ALDH1A1, the onset of germ cell meiosis is delayed. PMID: 26892828 Dioxin receptor regulates aldehyde dehydrogenase to block melanoma tumorigenesis and metastasis PMID: 26242870 these experiments reveal an evolutionarily conserved GABA synthesis pathway mediated by aldehyde dehydrogenase 1a1 (ALDH1a1). PMID: 26430123 Respiratory tract epithelial cells express retinaldehyde dehydrogenase ALDH1A and enhance IgA production by stimulated B cells in the presence of vitamin A. PMID: 24466150 Dkk-1 enhances resistance of osteosarcoma cells to stress by tipping balance of Wnt signaling in favor of the non-canonical Jun-mediated Wnt pathways. In turn, this results in transcriptional activation of ALDH1 through Jun-responsive promoter elements. PMID: 24577091 Deletion of Aldh1a1 exacerbated alpha-synuclein-mediated DA neurodegeneration and alpha-synuclein aggregation, whereas Aldh1a1-null and control DA neurons were comparably susceptible to 1-methyl-4-phenylpyridinium-, glutamate-, or camptothecin-induced cell death. PMID: 24865427 Our findings indicated that increased expression of ALDH1A1 in nasopharyngeal carcinoma was associated with enhanced invasiveness in the nude mouse. PMID: 23625387 PSMB8, ALDH1A1, and HSPA4 were identified to be located in ovarian tissues, to regulate 12 cellular pathways, and demonstrate age-dependent dynamic changes in expression profiling. PMID: 24156634 beta-escin inhibits tobacco carcinogen-induced lung tumor formation by modulating ALDH1A1-positive cells and RhoA/Rock signaling PMID: 23963803 ALDH1A1 deficiency induces BMP2 and increases bone mass in vivo. PMID: 23951127 retinoic acid-producing enzyme aldehyde dehydrogenase 1a1 (Aldh1a1) is an oncogene suppressor in specific B cell populations. PMID: 24080087 Expression of ALDH1A1 isozyme transcripts was highest in ALDH(very-br) cells, intermediate in ALDH(br) cells, and lowest in ALDH(dim) cells. PMID: 23484127 high fat diet mediates visceral fat formation through a sex-specific autocrine Aldh1 switch. PMID: 22933113 Retinaldehyde dehydrogenase 1 coordinates hepatic gluconeogenesis and lipid metabolism PMID: 22555438 analysis of neurodegeneration and motor dysfunction in mice lacking cytosolic and mitochondrial aldehyde dehydrogenases PMID: 22384032 This result demonstrates the critical role of stress resistance in myogenic cell therapy as well as confirms the role of ALDH as a marker for rapid isolation of murine and human myogenic progenitors for cell therapy. PMID: 22195027 data establish Aldh1a1 and its substrate Rald as previously unrecognized determinants of adipocyte plasticity and adaptive thermogenesis, which may have potential therapeutic implications PMID: 22561685 ALDH1A1 deficiency increases ALDH3A1 expression. Mice deficient in both ALDH3A1 & ALDH1A1 have fewer HSCs, aberrant cell-cycle distribution, increased reactive oxygen species, p38 MAP kinase activity & sensitivity to DNA damage. PMID: 22198153 expression can be detected in canals of Hering and bile duct epithelial cells and is increased on liver injury PMID: 21953779 in young adult animals with deletion of the Aldh1a1 gene there is altered dopamine metabolism and dysfunction of the dopamine transporter and dopamine release mechanisms PMID: 21784415 regulation of fat depots through the concerted action of Aldh1 enzymes establishes retinoic acid-dependent tandem regulation of transcription factors ZFP423 and PPARgamma in a depot-specific manner PMID: 21436255 Aldh1a1 plays a major role in cellular defense against oxidative damage induced by reactive lipid aldehydes in mouse liver PMID: 21256123 We observed a decrease in the average number of Aldh1a1-positive cells in tumours with a non-invasive vs. solid morphology and in the average number of Aldh1a1-positive mammary tumour cells in low vs. intermediate and low vs. high-nuclear grade tumours. PMID: 21059124 Retinoic acid-dependent signaling within the intestine is indispensable for RALDH enzyme activity in the draining mesenteric lymph nodes. PMID: 21220692 The addition of all trans retinoic acid blocked DEAB-mediated expansion of ST-HSCs in culture, suggesting that ALDH1a1 regulates HSC differentiation via augmentation of retinoid signaling. PMID: 20054864 Three retinaldehyde dehydrogenases (RALDH1, RALDH2 and RALDH3), show differential expression patterns throughout later mouse organogenesis PMID: 11744377 RA-generating activities in Raldh2-null mouse embryos could be ascribed to RALDH1 in eye, nasal, and inner ear epithelia. PMID: 12454286 RA signaling may be necessary only during early stages of retina development and is catalyzed by multiple enzymes, including Raldh1 PMID: 12808103 Raldh1 functions downstream of Adh1 in the oxidative metabolism of excess retinol PMID: 12851412 Expression of aldehyde dehydrogenase 1A1 (ALDH1A1) mRNA was found to be higher in brains of DBA/2 mice. PMID: 17010133 ALDH1A1 mRNA. 3-deoxyglucosone dehydrogenase activity was undetectable in tissues from ALDH1A1(-/-) mice. PMID: 17175089 Cellular expression of Aldh1 in the GI tract was studied. PMID: 17257171 corneal ALDH3A1 and lens ALDH1A1 protect the eye against cataract formation via nonenzymatic (light filtering) and enzymatic (detoxification) functions. PMID: 17567582 Aldh1a1 is not a critical regulator of adult stem cell function PMID: 18971422 the Aldh1a1 gene is strongly expressed in a male-specific manner in somatic cells of the developing testis, beginning shortly after Sry expression is first detectable PMID: 19618468

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Mouse Aldehyde Dehydrogenase 1A1 (ALDH1A1) Protein (His)

Recombinant Mouse Aldehyde Dehydrogenase 1A1 (ALDH1A1) Protein (His)

Product Overview

Target Details

FAQs