Recombinant Mouse 4-1BBL Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10586P
Recombinant Mouse 4-1BBL Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10586P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P41274 |
Synonym | 4 1BB L 4 1BB ligand 4 1BBL 4-1BB ligand 4-1BBL Cd137l Cd157l Homolog of mouse 4 1BB L Homolog of mouse 4 1BBL ILA ligand (TNF related) Ly63l Receptor 4 1BB ligand TNF superfamily member 9 TNFL9_HUMAN Tnfsf9 TNLG5A Tumor necrosis factor (ligand) superfamily member 9 Tumor necrosis factor ligand 5A Tumor necrosis factor ligand superfamily member 9 Tumor necrosis factor superfamily member 9 |
Description | Recombinant Mouse 4-1BBL Protein (His tag) was expressed in Mammalian. It is a Protein fragment |
Source | Mammalian |
AA Sequence | HHHHHHHHHHGGGSGGGSGGGSIEGRRTEPRPALTITTSPNLGTRENNAD QVTPVSHIGCPNTTQQGSPVFAKLLAKNQASLCNTTLNWHSQDGAGSSYL SQGLRYEEDKKELVVDSPGLYYVFLELKLSPTFTNTGHKVQGWVSLVLQA KPQVDDFDNLALTVELFPCSMENKLVDRSWSQLLLLKAGHRLSVGLRAYL HGAQDAYRDWELSYPNTTSFGLFLVKPDNPWE |
Molecular Weight | 226 kDa including tags |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C long term. |