Recombinant Mesobuthus Martensii Beta-Insect Depressant Toxin Bmkita (BMKITA) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00372P
Greater than 90% as determined by SDS-PAGE.
Recombinant Mesobuthus Martensii Beta-Insect Depressant Toxin Bmkita (BMKITA) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00372P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mesobuthus Martensii Beta-Insect Depressant Toxin Bmkita (BMKITA) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q9XY87 |
| Target Symbol | Q9XY87 |
| Species | Mesobuthus martensii (Manchurian scorpion) (Buthus martensii) |
| Expression System | E.coli |
| Tag | N-10His |
| Target Protein Sequence | DGYIRGSNGCKVSCLWGNEGCNKECRAYGASYGYCWTWGLACWCQGLPDDKTWKSESNTCG |
| Expression Range | 22-82aa |
| Protein Length | Partial |
| Mol. Weight | 12.8 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Depressant insect beta-toxins cause a transient contraction paralysis followed by a slow flaccid paralysis. They bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin also displays an evident analgesic effect but is devoid of any toxicity on mice. |
| Subcellular Location | Secreted. |
| Protein Families | Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family, Beta subfamily |
| Tissue Specificity | Expressed by the venom gland. |
![SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)](http://www.betalifesci.com/cdn/shop/files/1ihmbkjr21vdmc6j_{width}x.jpg?v=1753363793)
