Recombinant mCherry Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-9827P
Recombinant mCherry Protein (His tag)

Recombinant mCherry Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-9827P
Catalog No.: BLA-9827P

Product Overview

Host Species Anaplasma marginale
Accession X5DSL3
Description Recombinant mCherry Protein (His tag) was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMVSKGEEDNMAIIKEFMRFKVHMEGSVNGH EFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKH PADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLR GTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDA EVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGG MDELYK
Molecular Weight 29 kDa including tags
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed