Recombinant Human Zinc Finger Protein Gli1 (GLI1) Protein (His)

Name: Recombinant Human Zinc Finger Protein Gli1 (GLI1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-03561P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Zinc Finger Protein Gli1 (GLI1) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P08151
Target Symbol	GLI1
Synonyms	Gli 1; GLI; GLI family zinc finger 1; GLI Kruppel family member 1; gli1; GLI1_HUMAN; Glioma associated oncogene 1; Glioma associated oncogene homolog 1 (zinc finger protein) ; Glioma associated oncogene homolog; Glioma-associated oncogene; Oncogene GLI; Zfp 5; Zfp5; Zinc finger protein GLI 1; Zinc finger protein GLI1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	QEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYPTPSPCHENFVVGANRASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPPPSHDQRGSSGHTPPPSGPPNMAVGNMSVLLRSLPGETEFLNSSA
Expression Range	921-1106aa
Protein Length	Partial
Mol. Weight	23.3kDa
Research Area	Developmental Biology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Acts as a transcriptional activator. Binds to the DNA consensus sequence 5'-GACCACCCA-3'. Regulates the transcription of specific genes during normal development. Plays a role in craniofacial development and digital development, as well as development of the central nervous system and gastrointestinal tract. Mediates SHH signaling. Plays a role in cell proliferation and differentiation via its role in SHH signaling.; Acts as a transcriptional activator, but activates a different set of genes than isoform 1. Activates expression of CD24, unlike isoform 1. Mediates SHH signaling. Promotes cancer cell migration.
Subcellular Location	Cytoplasm. Nucleus.; [Isoform 2]: Cytoplasm. Nucleus.
Protein Families	GLI C2H2-type zinc-finger protein family
Database References	HGNC: 4317 OMIM: 165220 KEGG: hsa:2735 STRING: 9606.ENSP00000228682 UniGene: PMID: 29321573 The results provide new evidence of Numb and Gli1 on the clinical characteristics of Malignant pleural mesothelioma, which may be helpful in clinical diagnosis and targeted therapy. Further research with larger sample size is needed PMID: 30197333 Frameshift Mutation of GLI1 is associated with Colorectal Cancer. PMID: 28664474 Histone deacetylase 6 (HDAC6) inhibition enhanced glioma stem cells (GSCs) radiosensitivity via inactivating sonic hedgehog protein (SHH)/glioma-associated oncogene homolog 1 (Gli1) pathway. PMID: 29222038 HPI-1 worked more effectively than GANT-58 against breast carcinoma cells. In conclusion, HPI-1 could inhibit cell proliferation, reduce cell invasion and decrease cancer stem cell population in breast cancer cells. To target Gli-1 could be a potential strategy to suppress breast cancer stem cells. PMID: 29734730 High GLI1 expression is associated with unfavorable OS and FPS in patients with gastric cancer. As a member of the Hedgehog signaling pathway, GLI1 co-expressed genes are also largely enriched in PI3K/AKT pathway in gastric cancer. PMID: 29596399 the results suggest that aberrant expression of Gli1 serves a role in HSCR by targeting EDNRB. PMID: 29484400 Abnormal elevation of Gli1 and decrease of miR-361 were found in esophageal cancer tissues. MiR-361 weakened invasion of cancer cells and impeded EMT process via the inhibition of Gli1. PMID: 29125483 Data show that miR-150 inhibits glioma-associated oncogene homolog 1 (Gli1) expression via targeting 3'-UTR of Gli1 gene. PMID: 29081413 Downregulation of miR-150 and elevation of Gli1 promote the development and invasion of colorectal cancer cell Epithelial-mesenchymal transition (EMT). MiR-150 attenuated the progression of colorectal cancer cell EMT via inhibiting Gli1. PMID: 29164577 data collectively suggest that silencing of PRMT1 exerts anti-catabolic and anti-inflammatory effects on IL-1beta-induced chondrocytes via suppressing the Gli-1 mediated Hedgehog signaling pathway, indicating that PRMT1 plays a critical role in OA development and serves as a promising therapeutic target for OA. PMID: 28744817 Shh and Gli1 expression were associated with lymph node metastasis, TNM stage and tumor recurrence, suggesting Shh and Gli1 protein could become the valuable biomarker in evaluating the lymph node metastasis in oral squamous cell carcinoma. PMID: 28886265 we have identified an oncogenic MALAT1-GLI1 fusion gene in all cases of gastroblastoma that may serve as a diagnostic biomarker. PMID: 28731043 Analysis of fibroblasts from a patient with homozygous C-terminal truncation of GLI1 demonstrated that the corresponding mutant GLI1 protein is fabricated by patient cells and becomes upregulated in response to Hh signaling. PMID: 28973407 The results showed that Shh and Gli1 were upregulated in prostate cancer tissues and were targeted by a phytogenic neoplastic compound carnosol. PMID: 28886322 Our finding demonstrated that triple phosphorylation of GLI1 by AMPK on Ser-102, Ser-408 and Thr-1074 increases the cytoplasmic localization and binding stability to E3 ligase beta-TrCP, ultimately driving GLI1 protein degradation. PMID: 28562331 Our results identify a new molecular mechanism involving miR-326 and Arrb1 as regulators of Sonic hedgehog medulloblastoma Cancer stem cells . Specifically, low levels of Arrb1 and miR-326 trigger and maintain Hh/Gli signaling and self-renewal PMID: 28716052 study reveals that the USP48-Gli1 regulatory axis is critical for glioma cell proliferation and glioblastoma tumorigenesis. PMID: 28623188 Gli-1 is a credible indicator for highly aggressive tumor with poor prognosis in gastric cancer patients [meta-analysis] PMID: 27634907 Gli may be critical for lung adenocarcinoma metastasis. A novel Gli inhibitor shows promise as a therapeutic agent by preventing cell migration and invasion in vitro and significantly reducing tumor growth and increasing E-Cadherin expression in vivo. PMID: 27533453 Hedgehog pathway dysregulation contributes to the pathogenesis of human gastrointestinal stromal tumors via GLI-mediated activation of KIT expression. PMID: 27793025 Data demonstrate involvement of transcription and of DNA replication licensing factors by non-transcriptional and transcriptional mechanisms in the GLI-dependent mechanism of action of GANT61 in Ht29 cells. PMID: 27863397 Oxytocin receptor signaling promoted the angiogenic behaviors of HUVECs via Gli1-indcued transcription of HIF-1alpha. PMID: 28445928 Galectin-1 promotes invasion and epithelial mesenchymal transformation in gastric cancer cells via activation of the non-canonical Hh pathway in Gli-1 dependent manner. PMID: 27835885 The mechanism by which GLI1 loss of function sensitized tumor cells to vorinostat-induced apoptosis is at least in part through interactions with vorinostat to alter gene expression in a manner that favored apoptosis. PMID: 26868908 these findings propose that A3AR agonist induces cell cycle arrest and apoptosis in breast cancer stem cells by inhibition of ERK1/2 and GLI-1 cascade. PMID: 28230290 Gli1 could be a stem cell marker and an indicator of poor prognosis in patients with ductal breast carcinoma. PMID: 28965964 Expression of SHH and GLI1 may be useful prognostic markers of Merkel cell carcinoma because increased expression was associated with better prognosis. Report high rate of silent mutations in GLI1 exon 5. PMID: 28551328 Results found that GLI1 expression is regulated by GAL1 in gastric cancer tissue specimen and cell lines. PMID: 27836001 Results indicated that GLI1 activation in TN-IBC as in TNBC, plays a vital role in promoting cell proliferation, motility, tumor growth, and formation of tumor emboli. PMID: 28965853 High gli1 expression is associated with Small Cell Lung Cancer. PMID: 28870922 This inhibitory effect on cell growth was partially rescued by exogenous KRT17 expression. In the KRT17-positive regions in OSCCs, GLI-1 or GLI-2 was frequently detected, and the number of cells with cleaved caspase-3 positive was decreased. CONCLUSIONS: KRT17 promotes tumor cell growth, at least partially, through its anti-apoptotic effect as a result of the KRT17 overexpression by GLIs in OSCC PMID: 28342001 Results indicate that GLI1 is important for maintaining the invasive and mesenchymal-like properties of melanoma cells independent of MITF. PMID: 28635133 The data described herein provide the first identification of a DYRK1A-mediated site of phosphorylation on GLI1 within its NLS and may serve as a valuable mechanism for further understanding Hh signaling modulation. PMID: 28735864 Case Report: gastric pericytoma harboring the exceptionally rare translocation t(7;12) resulting in ACTB-GLI1 gene fusion. PMID: 26980027 USP21 recruits and stabilises Gli1 at the centrosome. PMID: 27621083 Gli1 expression was significantly correlated with T stage lymph node metastasis, and clinical stage of lung squamous cell carcinoma. PMID: 28286162 Gli1 role in cell proliferation and differentiation PMID: 28458545 Gli1 inhibitor GANT61 and SHH siRNA synergistically enhanced cytotoxicity induced by itraconazole in MCF-7 cells. PMID: 27810405 Hedgehog pathway activation in T-cell acute lymphoblastic leukemia predicts response to SMO and GLI1 inhibitors. PMID: 27694322 Our studies demonstrate an important role for smoothened and glioma-associated oncogene homology-1 in gastric cancer and suggest inhibition of hedgehog pathway as a novel and potent strategy to treat gastric cancer patients PMID: 28675107 GANT61, which is a targeted inhibitor of Gli1 and Gli2, decreased cell viability and promoted cell apoptosis. Thus, TGF-b1 induced EMT in neuroblastoma cells to increase their migration. Specifically, EMT induced by TGF-b1 in neuroblastoma cells did not depend on the Smad signaling pathway, and the transcription factor Gli participated in TGF-b1-induced EMT independent of Smad signaling. PMID: 28393230 Gli1 expression was detected in most ERM specimens. Patients who had DR or OCT findings indicating chronic retinal insults showed higher Gli1 expression. Gli1 may have a role in the pathogenesis of ERM after chronic retinal insults. PMID: 28134963 Overexpression of GLI1 through a recurrent MALAT1-GLI1 translocation or GLI1 up-regulation delineates a pathogenically distinct subgroup of plexiform fibromyxomas with activation of the Sonic Hedgehog signalling pathway. PMID: 27101025 Gli1 and Gli2 exhibited different functions in the regulation of p63 expression or proliferation of p63(+) cells in Kras-AR driven tumors. PMID: 27760825 The results from this study demonstrate the potential importance of the two-stem-loop motif as a target region for the inhibition of the CRD-BP-GLI1 RNA interaction and Hedgehog signaling pathway. PMID: 27036131 High expression of gli1 is associated with glioma chemoresistance. PMID: 27662839 High Gli-1 expression is associated with pancreatic cancer. PMID: 26815504 Our study is the first to demonstrate the associations of high nuclear Gli1 expression with resistance to trastuzumab-based NAT and subsequent worse prognosis in HER2-positive disease. These findings suggest that the nuclear Gli1 protein may be a novel target of NAT for HER2-positive breast cancer. PMID: 26526577 GLI is an oncogenic transcription factor in the SHH pathway, and targeting GLI with GANT61 results in favourable antitumour activity and targeted therapy. PMID: 27601167

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.