Recombinant Human WHSC1/NSD2 Protein (Catalytic domain)

Beta LifeScience SKU/CAT #: BLA-9706P
Recombinant Human WHSC1/NSD2 Protein (Catalytic domain)

Recombinant Human WHSC1/NSD2 Protein (Catalytic domain)

Beta LifeScience SKU/CAT #: BLA-9706P
Catalog No.: BLA-9706P

Product Overview

Host Species Human
Accession O96028
Synonym FLJ23286 IL5 promoter REII region binding protein KIAA1090 MGC176638 MMSET MMSET type II Multiple myeloma SET domain containing protein type III Multiple myeloma SET domain protein Multiple myeloma SET domain-containing protein NSD 2 NSD2 NSD2_HUMAN Nuclear receptor binding SET domain protein 2 Nuclear SET domain-containing protein 2 Probable histone-lysine N-methyltransferase NSD2 Protein trithorax-5 REIIBP Trithorax/ash1 related protein 5 TRX5 TRX5 protein WHS Whsc1 Wolf Hirschhorn syndrome candidate 1 Wolf Hirschhorn syndrome candidate 1 protein Wolf-Hirschhorn syndrome candidate 1 protein
Description Recombinant Human WHSC1/NSD2 Protein (Catalytic domain) was expressed in E.coli. It is a Protein fragment
Source E.coli
AA Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSEGDRGSRYQGVRGIGRVFK NALQEAEARFREIKLQREARETQESERKPPPYKHIKVNKPYGKVQIYTAD ISEIPKCNCKPTDENPCGFDSECLNRMLMFECHPQVCPAGEFCQNQCFTK RQYPETKIIKTDGKGWGLVAKRDIRKGEFVNEYVGELIDEEECMARIKHA HENDITHFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVNGDT RVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCSGFLGDRPKTS TTLSSEEKGKKTKKKTRRRRAKGEGKRQSED
Molecular Weight 62 kDa including tags
Purity >= 82% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity Specific Activity: 0.036 pmol/min/μgAssay Conditions: Add 50 μL reaction mix (100 μM S-adenosylmethionine, and 50-250 ng WHSC1/NSD2 in HMT buffer 7) to wells coated with the substrate. Incubate at 37oC for 2 hours. Add antibody against methylated K36 residue of histone H3, incubate 1 hour. Then, add secondary HRP-labeled antibody and incubate 30 minutes. Finally, add HRP chemiluminescent substrates and read luminescence.
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Store at -80°C.
Recently viewed