Recombinant Human WHSC1/NSD2 Protein (Catalytic domain)
Beta LifeScience
SKU/CAT #: BLA-9706P
Recombinant Human WHSC1/NSD2 Protein (Catalytic domain)
Beta LifeScience
SKU/CAT #: BLA-9706P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | O96028 |
Synonym | FLJ23286 IL5 promoter REII region binding protein KIAA1090 MGC176638 MMSET MMSET type II Multiple myeloma SET domain containing protein type III Multiple myeloma SET domain protein Multiple myeloma SET domain-containing protein NSD 2 NSD2 NSD2_HUMAN Nuclear receptor binding SET domain protein 2 Nuclear SET domain-containing protein 2 Probable histone-lysine N-methyltransferase NSD2 Protein trithorax-5 REIIBP Trithorax/ash1 related protein 5 TRX5 TRX5 protein WHS Whsc1 Wolf Hirschhorn syndrome candidate 1 Wolf Hirschhorn syndrome candidate 1 protein Wolf-Hirschhorn syndrome candidate 1 protein |
Description | Recombinant Human WHSC1/NSD2 Protein (Catalytic domain) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSEGDRGSRYQGVRGIGRVFK NALQEAEARFREIKLQREARETQESERKPPPYKHIKVNKPYGKVQIYTAD ISEIPKCNCKPTDENPCGFDSECLNRMLMFECHPQVCPAGEFCQNQCFTK RQYPETKIIKTDGKGWGLVAKRDIRKGEFVNEYVGELIDEEECMARIKHA HENDITHFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVNGDT RVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCSGFLGDRPKTS TTLSSEEKGKKTKKKTRRRRAKGEGKRQSED |
Molecular Weight | 62 kDa including tags |
Purity | >= 82% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Specific Activity: 0.036 pmol/min/μgAssay Conditions: Add 50 μL reaction mix (100 μM S-adenosylmethionine, and 50-250 ng WHSC1/NSD2 in HMT buffer 7) to wells coated with the substrate. Incubate at 37oC for 2 hours. Add antibody against methylated K36 residue of histone H3, incubate 1 hour. Then, add secondary HRP-labeled antibody and incubate 30 minutes. Finally, add HRP chemiluminescent substrates and read luminescence. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Store at -80°C. |