Recombinant Human Von Hippel-Lindau Disease Tumor Suppressor (VHL) Protein (His)

Name: Recombinant Human Von Hippel-Lindau Disease Tumor Suppressor (VHL) Protein (His)
Brand: Beta LifeScience
SKU: BLC-02862P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Von Hippel-Lindau Disease Tumor Suppressor (VHL) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P40337
Target Symbol	VHL
Synonyms	Elongin binding protein; G7 protein; HRCA 1; HRCA1; Protein G7; pVHL; RCA 1; RCA1; VHL 1; VHL; VHL_HUMAN; VHL1; VHLH; Von Hippel Lindau; Von Hippel Lindau disease tumor suppressor; von Hippel Lindau syndrome; von Hippel Lindau tumor suppressor; Von Hippel Lindau tumor suppressor, E3 ubiquitin protein ligase; Von Hippel-Lindau disease tumor suppressor
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD
Expression Range	1-213aa
Protein Length	Full Length
Mol. Weight	28.2 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Involved in the ubiquitination and subsequent proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Seems to act as a target recruitment subunit in the E3 ubiquitin ligase complex and recruits hydroxylated hypoxia-inducible factor (HIF) under normoxic conditions. Involved in transcriptional repression through interaction with HIF1A, HIF1AN and histone deacetylases. Ubiquitinates, in an oxygen-responsive manner, ADRB2.
Subcellular Location	[Isoform 1]: Cytoplasm. Membrane; Peripheral membrane protein. Nucleus. Note=Found predominantly in the cytoplasm and with less amounts nuclear or membrane-associated. Colocalizes with ADRB2 at the cell membrane.; [Isoform 3]: Cytoplasm. Nucleus. Note=Equally distributed between the nucleus and the cytoplasm but not membrane-associated.
Protein Families	VHL family
Database References	HGNC: 12687 OMIM: 144700 KEGG: hsa:7428 STRING: 9606.ENSP00000256474 UniGene: PMID: 29813026 aldehyde dehydrogenase 2 (ALDH2) is found to be transcriptionally regulated by VHL and contributes to enhanced anthracyclines cytotoxicity in clear cell renal cell carcinoma cells. PMID: 28643803 Study suggests that reduced expression of PBRM1 and VHL in clear cell renal cell carcinoma is correlated with an increased tumor aggressiveness. Low VHL expression identified as a risk factor for worse patient overall survival. PMID: 29169846 The results of the present study also demonstrated a mutation in VHL associated with the VHL syndrome phenotype, which may be of future therapeutic benefit for the diagnosis of VHL syndrome. PMID: 29749453 Overexpression of VHL was more successful at inhibiting fibrosis compared with silencing HIF-1a plus HIF-2a. Normoxia-active HIF-1a or HIF-2a prevented the inhibitory effect of VHL on liver fibrosis, indicating that attenuating fibrosis via VHL is HIF-1a- and HIF-2a-dependent to some extent. PMID: 28112200 The inverse correlation between the VHL gene expression profile and alisertib sensitivity was further confirmed in human cancer xenografts models. Taken together, these results suggested that VHL loss could potentially serve as a biomarker for predicting the efficacy of AURKA inhibitors. PMID: 29845253 JMJD6 regulates VHL gene expression in the human placenta. VHL downregulation in preeclampsia is dependent on decreased JMJD6 demethylase activity due to hypoxia and reduced Fe2+ bioavailability. PMID: 29373688 Low VHL expression is associated with papillary thyroid carcinoma. PMID: 29340905 that the reduced expression of LimD1 and VHL might have synergistic effect on induction of HIF1alpha resulting increased cellular proliferation and progression of the disease. PMID: 29033184 A two-hit loss involving VHL predicted for clear-cell renal cell carcinoma(ccRCC ) and a better prognosis, whereas mutations in PTEN, TP53, or RELN predicted for Sarcomatoid clear-cell renal cell carcinoma and worse prognosis. PMID: 28710314 we report a rare case of renal-cell carcinoma and hereditary polycythemia. Genotyping revealed that the patient carried both a germline HIF2A mutation and a somatic VHL mutation. Both mutations result in overactivation of HIF2A and its downstream target genes PMID: 29172931 The co-transfection of VHL and PLN in HEK293 cells decreased PLN expression under oxidative stress, whereas knockdown of VHL increased PLN expression both under normal and oxidative stress conditions. PMID: 29068413 missense mutations in the VHL gene during sporadic CCRCC were studied to evaluate their specific localization in relation to binding sites for the proteins interacting with VHL. PMID: 28853079 epigenomic profiling of clear cell renal cell carcinoma (ccRCC) establishes a compendium of somatically altered cis-regulatory elements, uncovering new potential targets including ZNF395. Loss of VHL, a ccRCC signature event, causes pervasive enhancer malfunction, with binding of enhancer-centric HIF2a and recruitment of histone acetyltransferase p300 at preexisting lineage-specific promoter-enhancer complexes PMID: 28893800 Biochemical analyses demonstrate that Daam2 associates with VHL and facilitates its ubiquitination and degradation. PMID: 29053101 VHLdb presently contains 478 interactors, of which 117 have been manually curated, and 1,074 mutations. This makes it the largest available database for pVHL-related information PMID: 27511743 A mouse model based on concurrent ectopic expression of constitutively active Notch1 (NICD1) and deletion of the Vhl gene show the existence of nests of dysplastic cells in the kidney with a clear cytoplasm as a consequence of lipid accumulation, thus displaying a one important hallmark of human clear cell renal cell carcinoma. PMID: 27491826 VHL mutation is associated with paediatric pheochromocytoma and paraganglioma. PMID: 28432847 pVHL loss causes the transcriptional activation of hypoxia-inducible factor (HIF) target genes, including many genes that encode histone lysine demethylases. PMID: 28701475 VHL expression was associated with the presence of mutations, and the absence of expression was associated with nuclear grade and the presence of metastasis in clear cell renal cell carcinoma patients. PMID: 27836247 HIF-1alpha/miR-210 pathway is strongly activated in VHL mutated paragangliomas, weakly activated in SDHx mutated PGLs, and not activated in VHLdel- and SDHxwt/VHLwt-PGLs. PMID: 28036268 VHL missense mutations in the p53 binding domain show different effects on p53 signaling and HIFalpha degradation in clear cell renal cell carcinoma, enhancing tumor cell survival. PMID: 28052007 the structural model of the HIF2a-pVHL complex presented in this study enhances understanding of how HIF2a is captured by pVHL. Moreover, the important contact amino acids that we identified may be useful in the development of drugs to treat HIF2a-related diseases. PMID: 27902963 these findings demonstrate that USP9X is a novel regulator of Von Hippel-Lindau protein stability, and USP9X may be a therapeutic target for treatment of Von Hippel-Lindau protein-related tumors PMID: 27517496 To the best of our knowledge, this is the first report of the coexistence of VHL disease and CPT2 deficiency in the same individual. Based on findings from animal models, the case illustrates that mutations in the VHL gene might protect against renal damage caused by CPT2 gene mutations. PMID: 27034144 Our work provides the first evidence that VHL mutations positively correlate with PD-L1 expression in ccRCC and may influence the response to ccRCC anti-PD-L1/PD-1 immunotherapy. PMID: 26707870 VHL is one of the commonly disrupted genes in patients with Sarcomatoid Renal Cell Carcinoma. PMID: 26895810 This article puts together the sequential pathogenesis of VHL mutant Clear cell renal cell carcinoma (ccRCC) by elaborating these mechanisms and the interplay of oncogenic pathways, epigenetics, metabolism and immune evasion, with a perspective on potential therapeutic strategies. PMID: 27329246 VHL promoter region 7896829 which was hypermethylated with sunitinib treatment in metastatic clear cell renal cancer PMID: 27029034 Positive staining for pVHL was observed in cancerous areas but not in normal tissues in patients with tongue cancer PMID: 28549422 miR-92 can target the VHL transcript to repress its expression. PMID: 28952293 VHL gene expression is deregulated in the majority of papillary thyroid cancer tissues. PMID: 28089820 kidney-specific deletion of Vhl and Pbrm1, but not either gene alone, results in bilateral, multifocal, transplantable clear cell kidney cancers. PMID: 28329682 Loss of VHL gene is associated with paragangliomas. PMID: 28099933 It has been proposed that the archetypal linker protein Rootletin maintains centrosome cohesion in part through inhibition of VHL-mediated Cep68 degradation. PMID: 28089774 Results show that VHL missense mutations may exert mild, moderate or strong impact on protein stability. Besides the HIF binding domain, other pVHL binding sites seem to be non-randomly altered by missense mutations in sporadic clear cell renal cell carcinoma. PMID: 27530247 Data identify VHL as an E3 ligase with important cellular functions under both normoxic and hypoxic conditions. PMID: 28114281 Moderate/strong NEMO protein expression is more frequent in VHL wild-type ccRCCs. PMID: 26500060 The Absence of MCM7 weakened the interaction between Cep68 and VHL, whereas MCM7 overexpression facilitated the Cep68-VHL association. PMID: 28578000 this meta-analysis indicates that VHL gene alteration has no prognostic or predictive value in patients with clear cell renal cell carcinoma PMID: 28103578 Low VHL expression is associated with Clear cell renal cell carcinoma. PMID: 27841867 The negative feedback modulation between LncRNA-SARCC/AR complex and HIF-2alpha signaling may then lead to differentially modulated RCC progression in a VHL-dependent manner. Together, these results may provide us a new therapeutic approach via targeting this newly identified signal from LncRNA-SARCC to AR-mediated HIF-2alpha/C-MYC signals against RCC progression. PMID: 26973243 Our study reveals a novel mechanism regulating VHL proteostasis and function, which is significant for identifying new drug targets and developing new therapeutic approaches targeting VHL deficiency in VHL diseases. PMID: 26973240 The prefoldin subunit Pac10 (the human homolog VBP-1 binds to pVHL) is required for pVHL stability. Reduction of soluble functional pVHL might be crucial in VHL-related diseases. PMID: 27179072 Up-regulation of 14-3-3zeta in response to pVHL is important for the recruitment of PI3K to the cell membrane and for stabilization of soluble beta-catenin. PMID: 28666999 pVHL mediates K63-linked ubiquitination of IKKbeta, which plays a role in the regulation of IKK/NF-kappaB signalling. PMID: 27693634 VHL hypermethylation was significantly correlated with SLE. PMID: 27940592 by modulating hypoxia-inducible factor activity via up-regulation of VHL, FOXO3a (foxo3b) plays an important role in survival in response to hypoxic stress. PMID: 27777301 Results show that pVHL interacts with B-Myb for proteasomal degradation. This regulation of B-Myb by pVHL plays a critical role in von Hippel-Lindau disease. PMID: 27090638 The von Hippel-Lindau protein (pVHL)-dependent degradation of HIF-2a participates in the regulation of ERalpha expression. Additionally, HIF-2a forms a protein complex with ERa, and amino acids 396-823 of HIF-2a physically interact with the ligand-binding domain of ERa PMID: 27323688

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Von Hippel-Lindau Disease Tumor Suppressor (VHL) Protein (His)

Recombinant Human Von Hippel-Lindau Disease Tumor Suppressor (VHL) Protein (His)

Product Overview

Target Details

FAQs