Recombinant Human Vascular Endothelial Growth Factor B (VEGFB)

Name: Recombinant Human Vascular Endothelial Growth Factor B (VEGFB)
Brand: Beta LifeScience
SKU: BLC-00464P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Buy cytokines, chemokines, and growth factors for research online, Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins, Recombinant proteins fall special offers - tag-free proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Vascular Endothelial Growth Factor B (VEGFB) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P49765
Target Symbol	VEGFB
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	Tag-Free
Target Protein Sequence	HQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKK
Expression Range	31-129aa
Protein Length	Partial
Mol. Weight	11.3 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Growth factor for endothelial cells. VEGF-B167 binds heparin and neuropilin-1 whereas the binding to neuropilin-1 of VEGF-B186 is regulated by proteolysis.
Subcellular Location	Secreted. Note=Secreted but remains associated to cells or to the extracellular matrix unless released by heparin.
Protein Families	PDGF/VEGF growth factor family
Database References	HGNC: 12681 OMIM: 601398 KEGG: hsa:7423 STRING: 9606.ENSP00000311127 UniGene: PMID: 28523459 Data from clinical studies point out the changes in circulating or tissue expression levels of VEGF-B in obese compared with lean patients. PMID: 28798193 Cardiac transgenic vascular endothelial growth factor-B overexpression failed to protect heart transplants from ischemia-reperfusion injury. PMID: 27588416 renal VEGF-B expression correlates with the severity of Diabetic Kidney Disease. PMID: 28190774 Data show that metformin treatment reduces serum vascular endothelial growth factor B (VEGF-B) levels and ameliorates insulin resistance. PMID: 26387747 Frameshift mutations of VEGFB gene is associated with stomach and colorectal cancers. PMID: 25633991 fluid shear stress induces the synthesis of Insulin growth factor-2 and vascular endothelial growth factor (VEGF) B and D, which in turn transactivate MMP-12. PMID: 25435370 MMP9 may activate VEGF-B via PI3K/Akt signaling pathway. PMID: 25424698 Roles of vascular endothelial growth factor in amyotrophic lateral sclerosis. PMID: 24987705 Low VEGFB and VEGFD gene expression is associated with early-stage non-small cell lung cancer. PMID: 24145997 Our study suggested that VEGF-B was an angiogenesis factor in vitro and that ERK1/2 and p38-related signaling pathways were involved in these VEGF-B activities. PMID: 24374930 VEGF-B has possible roles in cardiac protection, energy metabolism support, and neuroprotectin [review] PMID: 24987005 High VEGF-B levels might correlate with the presence of hyperlipidemia and target organ damage in type 2 diabetic patients. PMID: 25001655 High VEGFB expression is associated with bone marrow metastasis in neuroblastoma. PMID: 23553333 VEGF-B might be an important ligand in the signalling between the tumor and preexisting blood vessels to ensure a functional blood supply for tumor survival. PMID: 23417498 we report significant associations with overall survival and distant failure for certain VEGF(VEGF-B) family members. PMID: 23728940 Data indicate that three miRs (miR-484, -642, and -217) were able to predict chemoresistance and vasculature of serous epithelial ovarian carcinomas through the regulation of the VEGFB and VEGFR2 pathways. PMID: 23697367 Expression of VEGF-B genes in glioma cell lines U87 is significantly changed under hypoxia and ischemic conditions. PMID: 23350126 In WT1 mutant cells, reduced VEGF(165)b was due to lack of WT1-mediated transcriptional repression of the splicing-factor kinase SRPK1 PMID: 22172722 analysis of binding of vascular endothelial growth factor-B by VEGFR-1(D2) PMID: 20501651 TIMP3 blocks the binding of VEGF to VEGF receptor-2 and inhibits downstream signaling and angiogenesis. PMID: 12652295 Results describe the crystal structure of human vascular endothelial growth factor-B (VEGF-B) and present a predicted model for the association of VEGF-B with the second domain of its receptor, VEGFR-1. PMID: 16616187 Basophils could play a role in angiogenesis and inflammation through the expression of several forms of VEGF-B and their receptors. PMID: 17082651 VEGFB, and receptor were highly expressed in dysplastic neurons. IR in astroglial and balloon cells was observed for VEGFA and its receptors Double-labeling also showed expression of VEGFA, VEGFB and VEGFR-1 in cells of the microglia/macrophage lineage. PMID: 18317782 VEGF-B appears to have a relatively restricted angiogenic activity in the ischemic heart. PMID: 18511699 Increased VEGFB expression is associated with hepatocellular carcinoma PMID: 18537151 Overexpression of vascular endothelial growth factor-B in mouse heart alters cardiac lipid metabolism and induces myocardial hypertrophy. PMID: 18757827 The structural features of the 'highly ordered' interaction of the Fab fragment of the antibody (Fab-2H10) with VEGF-B, is presented. PMID: 18930733 VEGF-B mRNA was not expressed either in normal urothelium or in bladder cancer. PMID: 19424629

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.