Recombinant Human UTP23 Protein

Beta LifeScience SKU/CAT #: BLA-9571P
Recombinant Human UTP23 Protein

Recombinant Human UTP23 Protein

Beta LifeScience SKU/CAT #: BLA-9571P
Catalog No.: BLA-9571P

Product Overview

Host Species Human
Accession Q9BRU9
Synonym 1700010I21Rik AI662478 BB238373 C8orf53 D530033C11R MGC14595 RGD1307179 rRNA processing protein UTP23 homolog rRNA-processing protein UTP23 homolog UTP 23 utp23 UTP23 small subunit (SSU) processome component homolog (yeast) UTP23_HUMAN
Description Recombinant Human UTP23 Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMGSMKITRQKHAKKHLGFFRNNFGVREPYQ ILLDGTFCQAALRGRIQLREQLPRYLMGETQLCTTRCVLKELETLGKDLY GAKLIAQKCQVRNCPHFKNAVSGSECLLSMVEEGNPHHYFVATQDQNLSV KVKKKPGVPLMFIIQNTMVLDKPSPKTIAFVKAVESGQLVSVHEKESIKH LKEEQGLVKNTEQSRRKKRKKISGPNPLSCLKKKKKAPDTQSSASEKKRK RKRIRNRSNPKVLSEKQNAEGE
Molecular Weight 31 kDa including tags
Purity Greater than 90% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed