Recombinant Human UTP23 Protein
Beta LifeScience
SKU/CAT #: BLA-9571P
Recombinant Human UTP23 Protein
Beta LifeScience
SKU/CAT #: BLA-9571P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q9BRU9 |
Synonym | 1700010I21Rik AI662478 BB238373 C8orf53 D530033C11R MGC14595 RGD1307179 rRNA processing protein UTP23 homolog rRNA-processing protein UTP23 homolog UTP 23 utp23 UTP23 small subunit (SSU) processome component homolog (yeast) UTP23_HUMAN |
Description | Recombinant Human UTP23 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSMKITRQKHAKKHLGFFRNNFGVREPYQ ILLDGTFCQAALRGRIQLREQLPRYLMGETQLCTTRCVLKELETLGKDLY GAKLIAQKCQVRNCPHFKNAVSGSECLLSMVEEGNPHHYFVATQDQNLSV KVKKKPGVPLMFIIQNTMVLDKPSPKTIAFVKAVESGQLVSVHEKESIKH LKEEQGLVKNTEQSRRKKRKKISGPNPLSCLKKKKKAPDTQSSASEKKRK RKRIRNRSNPKVLSEKQNAEGE |
Molecular Weight | 31 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |