Recombinant Human UCK2 Protein
Beta LifeScience
SKU/CAT #: BLA-9467P
Recombinant Human UCK2 Protein
Beta LifeScience
SKU/CAT #: BLA-9467P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q9BZX2 |
Synonym | Cytidine monophosphokinase 2 TSA903 UCK2 UK UMPK Uridine cytidine kinase 2 Uridine monophosphokinase 2 |
Description | Recombinant Human UCK2 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVD YRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKE ITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQ MKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPT KKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRK RQASESSSRPHLEHHHHHH |
Molecular Weight | 30 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle. |