Recombinant Human UCK2 Protein

Beta LifeScience SKU/CAT #: BLA-9467P
Recombinant Human UCK2 Protein

Recombinant Human UCK2 Protein

Beta LifeScience SKU/CAT #: BLA-9467P
Catalog No.: BLA-9467P

Product Overview

Host Species Human
Accession Q9BZX2
Synonym Cytidine monophosphokinase 2 TSA903 UCK2 UK UMPK Uridine cytidine kinase 2 Uridine monophosphokinase 2
Description Recombinant Human UCK2 Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVD YRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKE ITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQ MKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPT KKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRK RQASESSSRPHLEHHHHHH
Molecular Weight 30 kDa including tags
Purity Greater than 90% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle.
Recently viewed