Recombinant Human Type-2 Angiotensin Ii Receptor (AGTR2) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-04155P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Type-2 Angiotensin Ii Receptor (AGTR2) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-04155P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Type-2 Angiotensin Ii Receptor (AGTR2) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P50052
Target Symbol AGTR2
Synonyms AGTR 2; Agtr2; AGTR2_HUMAN; angiotensin II receptor type 2; Angiotensin II type-2 receptor; Angiotensin receptor 2; AT 2; AT2; ATGR 2; ATGR2; MRX 88; MRX88; Type 2 angiotensin II receptor; Type-2 angiotensin II receptor
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His-SUMO
Target Protein Sequence MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLD
Expression Range 1-45aa
Protein Length Partial
Mol. Weight 20.8kDa
Research Area Cardiovascular
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Receptor for angiotensin II. Cooperates with MTUS1 to inhibit ERK2 activation and cell proliferation.
Subcellular Location Cell membrane; Multi-pass membrane protein.
Protein Families G-protein coupled receptor 1 family
Database References

HGNC: 338

OMIM: 300034

KEGG: hsa:186

STRING: 9606.ENSP00000360973

UniGene: PMID: 29455433

  • rs5193, rs1403543 and rs12710567 of AT2R gene might have no effect on pregnancy-induced hypertension risk among Chinese Han women. PMID: 29714512
  • It was found that the AGTR2 A-allele is a candidate genetic marker for top-level power athletes. Carriers of the minor allele (A-allele in males and A/A genotype in females) may possess some molecular advantage in developing muscle strength and power traits. PMID: 29561708
  • Low levels of AT2R is associated with angiogenesis in bladder cancer. PMID: 28599664
  • angiotensin II type 2 receptor activation in inguinal adipocytes opposes norepinephrine-induced uncoupling protein-1 (UCP1) production and aspects of cellular respiration PMID: 27477281
  • loss of AT2 R is associated with podocyte loss/dysfunction and is mediated, at least in part, via augmented ectopic hedgehog interacting protein expression in podocytes PMID: 28722118
  • AGTR2, which encodes angiotensin II receptor type 2, plays a role in modulating uteroplacental circulation and harbors variants that may contribute to the risk of preeclampsia. It is unlikely that the association that we identified with AGTR2 indicates a risk of preeclampsia rather than of spontaneous preterm birth, because women with preeclampsia as a reason for their delivery were excluded from the Nordic studies. PMID: 28877031
  • In this genomewide association study, we found that variants at the EBF1, EEFSEC, AGTR2, WNT4, ADCY5, and RAP2C loci were associated with gestational duration and variants at the EBF1, EEFSEC, and AGTR2 loci with preterm birth. PMID: 28877031
  • crystal structures of human AT2R bound to an AT2R-selective ligand and to an AT1R/AT2R dual ligand, capturing the receptor in an active-like conformation PMID: 28379944
  • Suggest a gender-specific association between the AT2R -1332 A/G polymorphism and the occurrence of carotid plaque and the history of cerebrovascular insult in advanced carotid atherosclerosis. PMID: 27062416
  • Significant overrepresentation of AT2R-1332 AA genotype in female multiple sclerosis patients was found, compared to female controls. PMID: 27000216
  • Ang II-induced upregulation of ATF3 and SUMO1 in vitro and in vivo was blocked by Ang II type I receptor antagonist olmesartan. Moreover, Ang II induced ATF3 SUMOylation at lysine 42, which is SUMO1 dependent PMID: 26850942
  • The A1166C polymorphism of AT1R, A1675G and C3123A polymorphisms of AT2R were analyzed. The A1675G polymorphism of AT2R might be associated with preeclampsia PMID: 25816156
  • AT2R downregulates the expression of TGF-betaRII in human proximal tubule cells PMID: 26867007
  • Angiotensin II type 2 receptor is present in human semen and may be involved in the control of sperm motility and male fertility. PMID: 26616438
  • ATGR2 activation enhances ACE2 expression and activity and prevents TNF-alpha-stimulated ICAM-1 expression . PMID: 26163449
  • Our results support that the AGTR2 gene may contribute to the pathogenesis of UPJO and the genetic origin of CAKUT could vary according to phenotype expression PMID: 24995698
  • in colorectal cancer, AT2R expression showed an inverse correlation with tumor stage and liver metastasis PMID: 25138435
  • Suggest a key regulatory role of ATI and ATII in promoting cellular proliferation in infantile hemangioma, and establish a role for ACE and ATIIR2 in the proliferation of this tumour. PMID: 25713419
  • The AGTR2 gene C allele is associated with an increased proportion of slow-twitch muscle fibres. PMID: 24887114
  • Activation of intracellular angiotensin AT receptors induces rapid cell death in non-cycling uterine leiomyosarcoma cells. PMID: 25487516
  • Type 2 angiotensin II receptor (ATR2) expression was 3.5-fold higher in bronchoalveolar cells 1-6 h after lung with cardiopulmonary bypass transplantation. PMID: 24796630
  • Loss of angiotensin II type 2 receptor is associated with hepatocellular carcinoma. PMID: 24391821
  • Ang II induces corneal myofibroblasts resistance to apoptosis via activating NF-kappaB signaling pathway, and thus should be further investigated as a possible target for therapy of corneal fibrosis. PMID: 24917146
  • These data indicate that the role of AT2R in human diseased arteries is divergent although the AT2R-mediated vasorelaxation prevails. PMID: 24674681
  • G allele of AT2R - 1332 G:A polymorphism is associated with an increased risk of preeclampsia. PMID: 24440243
  • Angiotensin II type 2 receptor antagonists could be particularly useful in the treatment of chronic pain and hypersensitivity associated with abnormal nerve sprouting PMID: 23255326
  • In light of knowledge that AT2 R expression is regulated by oestrogen and that the prevalence of hypertension and cardiovascular risk is greater in women after menopause, AT2 R agonist therapy may represent an approach to treat hypertension. PMID: 23406015
  • AGTR2 C4599A in mothers, fathers and babies was associated with preeclampsia and this association was only apparent in pregnancies in which the women had a BMI >/= 25 kg/m(2), suggesting a gene-environment interaction. PMID: 23122839
  • angiotensin II type 2 receptor (AT2R) gene adenine/cytosine (A/C)-3123 polymorphism may be a marker associated with HDL metabolism by hypertension PMID: 22869520
  • The polymorphism at AT (2) R gene was associated with the risk for aldosterone-producing adenoma. PMID: 21671168
  • The expression of AT2R in aldosterone-producing adenoma of the adrenal gland was lower than that in normal adrenal gland tissues. AT2R expression was negatively related to plasma aldosterone concentration but positively related with plasma renin activity. PMID: 20714875
  • Dopamine and angiotensin type 2 receptors cooperatively inhibit sodium transport in human renal proximal tubule cells. PMID: 22710646
  • In the present study, we showed that the 3123 C/A polymorphism of AGT2R gene is not a significant factor for hypertension in a sample of Tunisian population PMID: 22987376
  • angiotensin II receptor type 2 receptors are indispensable during islet -like cell clusters maturation in vivo. PMID: 22162314
  • The data suggested that diameter of the retinal arterioles might be associated with the angiotensin II Type 2 Receptor 1675G/A polymorphism. PMID: 21850060
  • This study therefore confirms a hypertrophy-modulating effect for AT(2)R also in hypertrophic cardiomyopathy. PMID: 21163866
  • The present findings suggest that the homozygous form of the ATR gene may make improving systolic blood pressure and some obesity-related metabolic parameters through a dietary intervention difficult among obese women. PMID: 20371166
  • A1166C genetic variation of the angiotensin II type I receptor gene may not have a major role in susceptibility to coronary heart disease [meta-analysis] PMID: 20732682
  • ACE DD and AT2R GG genotypes are associated with chronic kidney disease and scarring in PUV PMID: 20149750
  • Angiotensin II type 2 receptor signaling significantly attenuates growth of murine pancreatic carcinoma grafts in syngeneic mice PMID: 20181281
  • Variations in AGTR1 and AGTR2 are associated with sudden cardiac arrest risk in a population-based case-control study. PMID: 19716087
  • The aim of this study was to test the hypothesis that ACE I/D and AT2R 1675G>A are more frequent in patients suffering from the most severe episodes of hypoglycaemia requiring medical emergency treatment. PMID: 19820429
  • The highest levels of expression of AT2R were found in early and mid TOP placentae compared to term pregnancy. PMID: 20304486
  • The constitutive and ligand-mediated activity as well as the signal transduction of the AT(2) receptor, focusing on adapter proteins which directly bind to this receptor, is discussed. PMID: 19759061
  • The loss of AT(2) receptor signalling is associated with increased renal injury and mortality in chronic kidney disease. PMID: 19861345
  • This review focuses on the role of the AT(2) receptor in the kidney. PMID: 19861347
  • The role of the AT(2) receptor on cardiovascular structure and disease, and the signalling pathways induced by its activation, is discussed. PMID: 19861349
  • This review focuses primarily on the common polymorphism -1332G/A of angiotensin II type 2 (AT(2)) receptor but also briefly mentions 3123C/A (located in the 3'-UTR). PMID: 19861351
  • Novel data from human oesophagus and jejunum suggest that the AT(1) receptor mediates muscular contractions and that the AT(2) receptor regulates epithelial functions. PMID: 19861352

    • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    More from All Products
    Tn5 Transposase
    • Expression system: E.coli;
    CAT#: TN5-BL01
    Sale
    SDS-PAGE analysis of Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein, CAT# BLT-08873P showing >85% purity under 15% SDS-PAGE (Reduced)
    Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein
    • Molecule: SHFL;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+sumo;
    • Sequence: 1-291;
    CAT#: BLT-08873P

    Save $50
    Sale
    SDS-PAGE analysis of Human SFTPA1 (Pulmonary Surfactant-Associated Protein A1) - Recombinant Protein, CAT# BLT-08790P showing >90% purity under 15% SDS-PAGE (Reduced)
    Human SFTPA1 (Pulmonary Surfactant-Associated Protein A1) - Recombinant Protein
    • Molecule: SFTPA1;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 21-248;
    CAT#: BLT-08790P

    Save $50
    Sale
    SDS-PAGE analysis of Human SFTPA2 (Pulmonary Surfactant-Associated Protein A2) - Recombinant Protein, CAT# BLT-08789P showing >90% purity under 15% SDS-PAGE (Reduced)
    Human SFTPA2 (Pulmonary Surfactant-Associated Protein A2) - Recombinant Protein
    • Molecule: SFTPA2;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 21-248;
    CAT#: BLT-08789P

    Save $50
    Sale
    SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein
    • Molecule: NDUFV1;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+SUMO;
    • Sequence: 21-464aa;
    CAT#: BLT-08321P

    Save $50
    Sale
    SDS-PAGE analysis of Human NEU2 (Sialidase-2) - Recombinant Protein, CAT# BLT-08142P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NEU2 (Sialidase-2) - Recombinant Protein
    • Molecule: NEU2;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 1-380aa;
    CAT#: BLT-08142P

    Save $50
    Recently viewed