Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 18 (TNFSF18) Protein (hFc-Flag), Active
Beta LifeScience
SKU/CAT #: BLC-05840P
Greater than 90% as determined by SDS-PAGE.
Activity Measured by its binding ability in a functional ELISA. Immobilized TNFRSF18 at 2 μg/ml can bind TNFSF18 , the EC 50 is 2.565 to 2.940 ng/ml. Biological Activity Assay
Activity Human TNFRSF18 protein hFc tag captured on COOH chip can bind Human TNFSF18 protein hFc and Flag tag with an affinity constant of 38.5 nM as detected by LSPR Assay. Biological Activity Assay
Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 18 (TNFSF18) Protein (hFc-Flag), Active
Beta LifeScience
SKU/CAT #: BLC-05840P
Collections: All products, Buy cytokines, chemokines, and growth factors for research online, Co-stimulatory receptors, High-quality cytokines for advanced research, High-quality recombinant proteins, Recombinant proteins fall special offers - active proteins, Tumor necrosis factors and receptors (tnfs)
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 18 (TNFSF18) Protein (hFc-Flag), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Activity | 1. Measured by its binding ability in a functional ELISA. Immobilized TNFRSF18 at 2 μg/ml can bind TNFSF18 , the EC 50 is 2.565 to 2.940 ng/ml. 2. Human TNFRSF18 protein hFc tag captured on COOH chip can bind Human TNFSF18 protein hFc and Flag tag with an affinity constant of 38.5 nM as detected by LSPR Assay. |
| Uniprotkb | Q9UNG2 |
| Target Symbol | TNFSF18 |
| Synonyms | (AITRL)(hGITRL)(AITRL)(GITRL)(TL6) |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | N-hFc-Flag |
| Target Protein Sequence | QLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS |
| Expression Range | 72-199aa |
| Protein Length | Partial |
| Mol. Weight | 42.8 |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Cytokine that binds to TNFRSF18/AITR/GITR. Regulates T-cell responses. Can function as costimulator and lower the threshold for T-cell activation and T-cell proliferation. Important for interactions between activated T-lymphocytes and endothelial cells. Mediates activation of NF-kappa-B. Triggers increased phosphorylation of STAT1 and up-regulates expression of VCAM1 and ICAM1. Promotes leukocyte adhesion to endothelial cells. Regulates migration of monocytes from the splenic reservoir to sites of inflammation. |
| Subcellular Location | Cell membrane; Single-pass type II membrane protein. |
| Protein Families | Tumor necrosis factor family |
| Database References | HGNC: 11932 OMIM: 603898 KEGG: hsa:8995 STRING: 9606.ENSP00000385470 UniGene: PMID: 27098050 |
![SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)](http://www.betalifesci.com/cdn/shop/files/1ihmbkjr21vdmc6j_{width}x.jpg?v=1753363793)
