Recombinant Human Tumor-Associated Calcium Signal Transducer 2 (TACSTD2) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05719P
Greater than 95% as determined by SDS-PAGE.
Activity Measured by its binding ability in a functional ELISA. Immobilized Human TROP2 at 2 μg/mL can bind Anti-TROP2 recombinant antibody , the EC 50 is 0.7284-1.075 ng/mL. Biological Activity Assay
Recombinant Human Tumor-Associated Calcium Signal Transducer 2 (TACSTD2) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05719P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Tumor-Associated Calcium Signal Transducer 2 (TACSTD2) Protein (His), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Activity | Measured by its binding ability in a functional ELISA. Immobilized Human TROP2 at 2 μg/mL can bind Anti-TROP2 recombinant antibody , the EC50 is 0.7284-1.075 ng/mL. |
| Uniprotkb | P09758 |
| Target Symbol | TACSTD2 |
| Synonyms | (Cell surface glycoprotein Trop-2)(Membrane component chromosome 1 surface marker 1)(Pancreatic carcinoma marker protein GA733-1) |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | C-10His |
| Target Protein Sequence | HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT |
| Expression Range | 27-274aa |
| Protein Length | Partial |
| Mol. Weight | 30.6 kDa |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | May function as a growth factor receptor. |
| Subcellular Location | Membrane; Single-pass type I membrane protein. |
| Protein Families | EPCAM family |
| Database References | HGNC: 11530 OMIM: 137290 KEGG: hsa:4070 STRING: 9606.ENSP00000360269 UniGene: PMID: 30098828 |
![SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)](http://www.betalifesci.com/cdn/shop/files/1ihmbkjr21vdmc6j_{width}x.jpg?v=1753363793)
