Recombinant Human Tumor-Associated Calcium Signal Transducer 2 (TACSTD2) Protein (hFc), Active

Name: Recombinant Human Tumor-Associated Calcium Signal Transducer 2 (TACSTD2) Protein (hFc), Active
Brand: Beta LifeScience
SKU: BLC-05583P
Price: 240.0 USD
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Activity Measured in cell activity assay using U937 cells, the EC 50 for this effect is 190.2-298.6 ng/ml. Biological Activity Assay

Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Back to school. back to lab. ready for results. - advance your research with beta lifescience, High-quality recombinant proteins, In-stock recombinant proteins, Other recombinant proteins

Price Save $167

Size

100ug

Quantity

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Tumor-Associated Calcium Signal Transducer 2 (TACSTD2) Protein (hFc), Active is produced by our Mammalian cell expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Activity	Measured in cell activity assay using U937 cells. The EC50 for this effect is 190.2-298.6 ng/ml.
Uniprotkb	P09758
Target Symbol	TACSTD2
Synonyms	TACSTD2; GA733-1; M1S1; TROP2; Tumor-associated calcium signal transducer 2; Cell surface glycoprotein Trop-2; Membrane component chromosome 1 surface marker 1; Pancreatic carcinoma marker protein GA733-1
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-hFc
Target Protein Sequence	HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Expression Range	27-274aa
Protein Length	Partial
Mol. Weight	56.8 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	May function as a growth factor receptor.
Subcellular Location	Membrane; Single-pass type I membrane protein.
Protein Families	EPCAM family
Database References	HGNC: 11530 OMIM: 137290 KEGG: hsa:4070 STRING: 9606.ENSP00000360269 UniGene: PMID: 30098828 TROP-2, SLP-2 and CD56 were effective diagnostic markers for PTC, especially when they were combined to use. PMID: 29951933 Trop2 has a potential role in the promotion of EMT in BC. PMID: 29901160 these results suggested that TROP2 may promote osteosarcoma cell proliferation and migration via PI3K/AKT signaling and may serve as a novel treatment target for osteosarcoma . PMID: 29845216 TACSTD2 downregulation is associated with hepatocellular carcinoma. PMID: 29538454 findings demonstrate that a membranous TROP-2 staining pattern is highly specific for PTC, which may serve as a potential diagnostic marker aiding in the accurate classification of morphologically equivocal thyroid follicular-patterned lesions PMID: 26862947 TROP2 promoted the proliferation, migration and metastasis of gallbladder cancer cells by regulating PI3K/AKT pathway and inducing EMT. PMID: 28423362 The results from clinical specimens showed that Trop2 expression correlated with MMP2 expression in primary thyroid cancer. The current study suggests that elevated expression of Trop2 may represent an important molecular hallmark that is biologically and clinically relevant to the progression of thyroid cancer. PMID: 28709407 these results suggest a differential role for TROP2 in different lung cancer subtypes PMID: 28404926 Results show that TROP2 expression is up-regulated in gastric tumor and its co-expression with AREG protein is associated with TNM stage, tumor size, lymph node metastases, and distant metastases. PMID: 28256068 Our findings indicate that the expression of Trop-2 is a stringent predictor of tumor response to AKT inhibitors. They also support the identification of activatory pathways, as efficient predictors of response in precision cancer therapy. PMID: 27022065 Findings suggest that high TROP2 expression identifies distinct cell sub-populations in androgen-sensitive and androgen-independent prostate tumors and that it may be a predictive biomarker for prostate cancer treatment response in androgen-sensitive tumors. PMID: 27283984 TROP2 may play a crucial role in COPD by affecting basal cells function and thus airway remodeling through increased basal cells hyperplasia PMID: 27887617 TROP2 was overexpressed specifically in the majority of epithelial ovarian cancer and may be a novel prognostic biomarker PMID: 27127000 we compared the diagnostic value of TROP-2 expression in distinguishing between benign and malignant thyroid lesions to those of HBME-1, CK19 and galectin-3 PMID: 28547974 TROP-2 membranous staining is a very sensitive and specific marker for the classic and tall cell variants of papillary thyroid carcinoma, and for papillary microcarcinomas , with high overall specificity for papillary thyroid carcinoma PMID: 27311870 The results suggested that trop2 facilitated neovascularization of non-small-cell lung cancer via activating ERK1/2 signaling pathway. PMID: 28345466 We identified a homozygous TACSTD2 missense mutation, c.551A>G, p.(Tyr184Cys), in the affected family members. Both parents were heterozygous for the mutation, and unaffected siblings were either heterozygous or homozygous wild-type for this allele. PMID: 27227392 Our results expand the mutational spectrum of TACSTD2 in patients with gelatinous drop-like corneal dystrophy (GDLD). PMID: 27149532 Trop2 expression was higher in GC tissues than in neighboring non-tumor tissues. Increased Trop2 protein levels in GC were associated with increased differentiation, tumor node metastasis stage, tumor size, lymph node metastasis, distant metastasis, and H. pylori infection. PMID: 26716416 Trop-2 is a novel target for ADC therapy because of its high expression by many solid cancers. PMID: 26101915 TROP2 is epigenetically down-regulated and operates as a negative regulator of cell proliferation and migration in liver fluke-associated cholangiocarcinoma. PMID: 26626643 TROP-2 is specifically expressed in papillary thyroid carcinoma. PMID: 26481593 overexpression of TROP2 appears to be an independent predictor for poor clinical outcome in nasopharyngeal carcinoma PMID: 26617817 Lower GA733-2 expression in cancer tissues appeared to correlate with lymph node metastases (P < 0.05). GA733-1 gene expression was significantly higher in cancerous samples PMID: 26600538 TROP-2 can be used as well as HBME-1 in thyroid cytology to detect PTC. PMID: 25164548 Altogether, our data suggest that TROP2 plays an important role in promoting ADC and may represent a novel prognostic biomarker and therapeutic target for the disease. PMID: 26773504 TROP2 protein is expressed at high levels in the colon cancer tissues. PMID: 26059528 TACSTD2 protein, human is predicting lymph node metastases in OSCC, overall survival and disease-free survival. PMID: 24764155 The amino acid exchange resulting from 4461T[C does not appear to alter binding of HO-3, suggesting that treatment with catumaxomab can be offered to patients regardless of their TACSTD1-genotype. PMID: 26115884 These observations suggest that Trop2 serves an oncogenic role in LSCC and has potential as a therapeutic target PMID: 25779928 This study reveals that both EpCAM and Trop2 overexpression in pituitary adenomas correlate significantly with invasiveness and proliferation. Follow-up analysis shows that Trop2 is a predictive factor for recurrence/progression for PAs. PMID: 25550831 Trop2 loss triggers sensitivity to anti-ErbB3 antibodies, which results in reduced proliferation and tumorigenic growth of Trop2 negative head and neck squamous cell cancer cells. PMID: 25238142 studies have begun to identify the mechanisms underlying TROP2's functions, including regulated intramembrane proteolysis or specific interactions with integrin b1 and claudin proteins. PMID: 25523132 we demonstrate that the Trop-2 activation states are critical determinants of tumor progression and are powerful indicators of breast cancer patients survival. PMID: 24824621 Inhibition of Tacstd2 expression significantly inhibited chemotherapeutic reagent-induced apoptosis, and TACSTD2 regulated apoptotic gene expression through P63 containing the transactivation domain (TAp63). PMID: 24651436 Trop2 is important in proliferation and apoptosis regulation in CaSki cells, which may become a novel target for cervical cancer treatment. PMID: 24816726 Overexpression of TROP2 predicts poor prognosis of patients with cervical cancer and promotes the proliferation and invasion of cervical cancer cells by regulating ERK signaling pathway. PMID: 24086649 miR-125b-1 causes mitogen-activated protein kinase pathway dysfunction through regulation of TACSTD2 expression. PMID: 23416980 The results of this study suggested that the TROP2 correlated with malignancy, proliferation and angiogenesis in human gliomas PMID: 23397225 TROP2 gene expression can be used as an independent prognostic indicator for squamous cell carcinoma of the larynx. PMID: 22987366 Used the Sf9 cells to express the Trop2 ectodomain (Trop2EC) in two forms - wt glycosylated (gTrop2EC) and mutant non-glycosylated form (Trop2EC(Delta/N)). Recombinant protein was purified and structure studied. PMID: 23872121 Trop2 expression reflects a more malignant phenotype and may serve as an unfavorable prognostic factor for extranodal NK/T cell lymphoma, nasal type PMID: 23979406 The cells exhibited a low epithelial barrier function as well as decreased expression of tight-junction-related proteins claudin 1 and 7. PMID: 23868985 show that Trop-2 enhances directional prostate cancer cell migration, through modulation of Rac1 GTPase activity PMID: 23536555 Network hubs and interacting partners are co-expressed with Trop-2 in primary human tumours, supporting a role of this signalling network in cancer growth. PMID: 22562244 study characterized the expression of TACSTD2 in invasive ductal breast cancer(IDC) and adjacent non-malignant tissues; studies demonstrated that the high expression of TACSTD2 correlates with a poor prognosis in IDC PMID: 23031786 Our data support a model where above-baseline expression of wild-type Trop-2 is a key driver of human cancer growth. PMID: 22349828 High expression of TROP2 was associated with stage stage IIb colon cancer. PMID: 23055188 More than 90% of Gelatinous drop-like corneal dystrophy (GDLD) patients possessed the same haplotype with a Q118X mutation in TACSTD2. PMID: 23038033

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Tumor-Associated Calcium Signal Transducer 2 (TACSTD2) Protein (hFc), Active

Recombinant Human Tumor-Associated Calcium Signal Transducer 2 (TACSTD2) Protein (hFc), Active

Product Overview

Target Details

FAQs