Recombinant Human Tropomyosin 1 (alpha) Protein

Beta LifeScience SKU/CAT #: BLA-9251P
Recombinant Human Tropomyosin 1 (alpha) Protein

Recombinant Human Tropomyosin 1 (alpha) Protein

Beta LifeScience SKU/CAT #: BLA-9251P
Catalog No.: BLA-9251P

Product Overview

Host Species Human
Synonym AA986836 AI854628 Alpha tropomyosin alpha-TM Alpha-tropomyosin C15orf13 cardiomyopathy, hypertrophic 3 CMD1Y CMH3 HTM alpha HTM-alpha OTTHUMP00000163688 sarcomeric tropomyosin kappa TM2 Tmpa TMSA Tpm-1 TPM1 TPM1_HUMAN Tropomyosin 1 tropomyosin 1 (alpha) tropomyosin 1 (alpha) isoform 1 tropomyosin 1 (alpha) isoform 2 tropomyosin 1 (alpha) isoform 3 tropomyosin 1 (alpha) isoform 4 tropomyosin 1 (alpha) isoform 5 tropomyosin 1 (alpha) isoform 6 tropomyosin 1 (alpha) isoform 7 Tropomyosin alpha 1 chain Tropomyosin alpha-1 chain Tropomyosin, skeletal muscle alpha Tropomyosin-1
Description Recombinant Human Tropomyosin 1 (alpha) Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKL KGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELD RAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKE AKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTV TNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLE KSIDDLEEKVAHAKEENLSMHQMLDQTLLELNNM
Molecular Weight 35 kDa including tags
Purity >95% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C.
Recently viewed