Recombinant Human TRIM21/SS-A Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-9197P
Recombinant Human TRIM21/SS-A Protein (Tagged)

Recombinant Human TRIM21/SS-A Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-9197P
Catalog No.: BLA-9197P

Product Overview

Host Species Human
Accession P19474
Synonym 52 kDa ribonucleoprotein autoantigen Ro/SS-A 52 kDa Ro protein 52kD Ro/SSA autoantigen Autoantigen Ro/SSA, 52-KD E3 ubiquitin-protein ligase TRIM21 RING finger protein 81 RNF81 Ro 52 Ro(SS-A) Ro52 RO52_HUMAN Sicca syndrome antigen A Sjoegren syndrome type A antigen Sjogren syndrome antigen A1 Sjogren syndrome type A antigen SS-A SSA SSA1: Sjogren syndrome antigen A1 (52kDa ribonucleoprotein autoantigen SS-A/Ro) TRIM21 Tripartite motif protein TRIM21 Tripartite motif-containing 21 Tripartite motif-containing protein 21
Description Recombinant Human TRIM21/SS-A Protein (Tagged) was expressed in Wheat germ. It is a Protein fragment
Source Wheat germ
AA Sequence QLANMVNNLKEISQEAREGTQGERCAVHGERLHLFCEKDGKALCWVCAQS RKHRDHAMVPLEEAAQEYQEKLQVALGELRRKQELAEKLEVEIAIKRADW KKTVETQK
Molecular Weight 38 kDa including tags
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed