Recombinant Human TRIM21/SS-A Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-9197P
Recombinant Human TRIM21/SS-A Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-9197P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P19474 |
Synonym | 52 kDa ribonucleoprotein autoantigen Ro/SS-A 52 kDa Ro protein 52kD Ro/SSA autoantigen Autoantigen Ro/SSA, 52-KD E3 ubiquitin-protein ligase TRIM21 RING finger protein 81 RNF81 Ro 52 Ro(SS-A) Ro52 RO52_HUMAN Sicca syndrome antigen A Sjoegren syndrome type A antigen Sjogren syndrome antigen A1 Sjogren syndrome type A antigen SS-A SSA SSA1: Sjogren syndrome antigen A1 (52kDa ribonucleoprotein autoantigen SS-A/Ro) TRIM21 Tripartite motif protein TRIM21 Tripartite motif-containing 21 Tripartite motif-containing protein 21 |
Description | Recombinant Human TRIM21/SS-A Protein (Tagged) was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | QLANMVNNLKEISQEAREGTQGERCAVHGERLHLFCEKDGKALCWVCAQS RKHRDHAMVPLEEAAQEYQEKLQVALGELRRKQELAEKLEVEIAIKRADW KKTVETQK |
Molecular Weight | 38 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | E3 ubiquitin-protein ligase whose activity is dependent on E2 enzymes, UBE2D1, UBE2D2, UBE2E1 and UBE2E2. Forms a ubiquitin ligase complex in cooperation with the E2 UBE2D2 that is used not only for the ubiquitination of USP4 and IKBKB but also for its self-ubiquitination. Component of cullin-RING-based SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes such as SCF(SKP2)-like complexes. A TRIM21-containing SCF(SKP2)-like complex is shown to mediate ubiquitination of CDKN1B ('Thr-187' phosphorylated-form), thereby promoting its degradation by the proteasome. Monoubiquitinates IKBKB that will negatively regulates Tax-induced NF-kappa-B signaling. Negatively regulates IFN-beta production post-pathogen recognition by polyubiquitin-mediated degradation of IRF3. Mediates the ubiquitin-mediated proteasomal degradation of IgG1 heavy chain, which is linked to the VCP-mediated ER-associated degradation (ERAD) pathway. Promotes IRF8 ubiquitination, which enhanced the ability of IRF8 to stimulate cytokine genes transcription in macrophages. Plays a role in the regulation of the cell cycle progression. Enhances the decapping activity of DCP2. Exists as a ribonucleoprotein particle present in all mammalian cells studied and composed of a single polypeptide and one of four small RNA molecules. At least two isoforms are present in nucleated and red blood cells, and tissue specific differences in RO/SSA proteins have been identified. The common feature of these proteins is their ability to bind HY RNAs.2. Involved in the regulation of innate immunity and the inflammatory response in response to IFNG/IFN-gamma. Organizes autophagic machinery by serving as a platform for the assembly of ULK1, Beclin 1/BECN1 and ATG8 family members and recognizes specific autophagy targets, thus coordinating target recognition with assembly of the autophagic apparatus and initiation of autophagy. Acts as an autophagy receptor for the degradation of IRF3, hence attenuating type I interferon (IFN)-dependent immune responses. Represses the innate antiviral response by facilitating the formation of the NMI-IFI35 complex through 'Lys-63'-linked ubiquitination of NMI. |
Subcellular Location | Cytoplasm. Cytoplasmic vesicle, autophagosome. Nucleus. Cytoplasm, P-body. Note=Enters the nucleus upon exposure to nitric oxide. Localizes to small dot- or rod-like structures in the cytoplasm, called processing bodies (P-bodies) that are located underneath the plasma membrane and also diffusely in the cytoplasm. They are located along the microtubules and are highly motile in cells. Colocalizes with DCP2 in P-bodies. |
Protein Families | TRIM/RBCC family |
Database References | |
Tissue Specificity | Isoform 1 and isoform 2 are expressed in fetal and adult heart and fetal lung. |
Gene Functions References
- the TRIM21 knockdown increases SALL1 levels, indicating that TRIM21 degrades both SALL1 and SALL4. PMID: 29511085
- The expression of TRIM21 mRNA and protein was significantly higher in Systemic lupus erythematosus PBMCs as compared to healthy controls. There was a correlation between TRIM21 mRNA expression and Systemic lupus erythematosus activities. PMID: 29385873
- Low TRIM21 expression is associated with RNA virus infections. PMID: 29743353
- TRIM21 positively regulated osteosarcoma cell proliferation. Overexpression of TRIM21 enhanced osteosarcoma cell tolerance toward various stresses. YWHAZ protein was identified as a novel interacting partner of TRIM21 and its expression levels were negatively regulated by TRIM21. PMID: 29673441
- expression increased in lesional psoriatic skin PMID: 27943421
- when misfolded tau assemblies enter the cell, they can be detected and neutralized via a danger response mediated by tau-associated antibodies and the cytosolic Fc receptor tripartite motif protein 21 (TRIM21) PMID: 28049840
- Taken together, the current study provides evidence of new function of Ro60/SSA in the development of cancer. It facilitates pancreatic cancer proliferation, migration and invasion. Therefore, it may represent a novel molecular target for the management of pancreatic cancer. PMID: 29274781
- We suggest that TRIM21 may be one of the factors associated with the "switching on" the proinflammatory programme in CD16(+) monocytes or monocyte-derived macrophages. PMID: 27773663
- Authors demonstrate that TRIM21 expression predicts survival in pancreatic cancer patients. This work highlights a novel mechanism of Par-4 regulation, and identifies a novel prognostic marker and potential therapeutic target for pancreatic cancer. PMID: 27830973
- TRIM21 role in TRAIL-induced apoptosis PMID: 27219672
- Our data suggest that patients with IIM, mainly DM, are characterized by a deficient expression of Ro52/TRIM21 in different PBMC subsets (CD4(+) lymphocytes and monocytes), along with lower K48-mediated ubiquitination, which is associated with a proinflammatory cytokine response. PMID: 27936488
- Significant relationships were found between clinical and laboratory manifestations of autoimmune and rheumatic diseases with different patterns of antibodies to anti-Ro52, anti-Ro60 and anti-La . PMID: 26725021
- downregulation of miR-1207-5p and miR-4695-3p expression may lead to increased TRIM21 levels in the minor salivary glands, which contributes to the development of Sjogren's syndrome PMID: 26888739
- The interaction of TRIM21 and LFG was analyzed by co-immunoprecipitation. To examine changes in regulatory processes, western blot analyses, real-time PCR, activity of apoptotic process and flow cytometric analyses were carried out. PMID: 26398169
- TRIM21 plays an essential role in p62-regulated redox homeostasis and may be a viable target for treating pathological conditions resulting from oxidative damage. PMID: 26942676
- TRIM21-induced exposure of the viral genome promotes sensing of DNA and RNA viruses by cGAS and RIG-I PMID: 26506431
- we prove that TRIM21 is a potential tumor suppressor in hepatocellular carcinoma and its low expression indicates poor prognosis PMID: 26055142
- Trim21 regulates Nmi-IFI35 complex-mediated inhibition of innate antiviral response PMID: 26342464
- TRIM20 and TRIM21 mediate precision autophagy, controlling the hub signaling machineries and key factors, inflammasome and type I interferon, directing cardinal innate immunity response systems in humans. PMID: 26347139
- This study elucidates a complex mechanism of step-wise ubiquitination and deubiquitination activities that allows contemporaneous innate immune signaling and neutralization by TRIM21. PMID: 26150489
- Anti-Ro52/TRIM21 antibodies are independently associated with the presence of interstitial lung disease and poor survival in systemic sclerosis. PMID: 26315678
- Endoplasmic reticulum stress causes autophagy and apoptosis leading to cellular redistribution of the SS-A and SS-B autoantigens in salivary gland epithelial cells of Sjogren's syndrome patients. PMID: 25845745
- These data extend the protective role of TRIM21 from viruses to bacteria and thereby strengthening the general role of antibody-dependent intracellular neutralisation in cellular immunity. PMID: 24920099
- Upregulation of SSA1 is associated with alcoholic and nonalcoholic steatohepatitis. PMID: 25526666
- TRIpartite motif 21 (TRIM21) differentially regulates the stability of interferon regulatory factor 5 (IRF5) isoforms. PMID: 25084355
- Report association of Anti-Ro/SSA-p200 antibodies with congenital heart block. PMID: 25327946
- Although protein expression levels were not affected significantly, the late up-regulation of Ro52/TRIM21 mRNA was accompanied by protein redistribution PMID: 25098814
- the up-regulation of Ro52 in ductal epithelium might be a triggering factor for disease progression in Sjogren's syndrome. PMID: 24673429
- Cytoplasmic sequestration of GMPS requires ubiquitylation by TRIM21. PMID: 24462112
- epitope peptide of the TRIM21 (TRIM: tripartite motif) autoantigen that is recognized by a polyclonal antibody was determined as assembling an "L-E-Q-L" motif on an alpha-helix PMID: 24094071
- Regulation of TRIM-21 expression occurs through an ERalpha-dependent mechanism, a pathway that was observed to be overactive in SLE patients. PMID: 24449583
- Autoantibodies to the RING domain of Ro52 significantly correlate with disease activity in systemic lupus erythematosus. PMID: 23554036
- Our data demonstrate that multiple IRFs tightly regulate expression of Trim21 in immune cells. PMID: 23975864
- This retrospective study supports the routine distinction of anti-SSA/Ro60 and anti-Ro52/TRIM21 due to their different clinical associations. PMID: 23039326
- Anti-TRIM21 antibodies were the second most common autoantibodies in this systemic sclerosis cohort. PMID: 22394602
- Data suggest that the identification of the SS-A/Ro pattern at the ANA-HEp-2 screening routine shall lead to specific tests for the identification of anti-SS-A/Ro antibodies. PMID: 23357050
- Intracellular antibody-bound pathogens stimulate immune signaling via the Fc receptor TRIM21. PMID: 23455675
- Anti-Ro52 antibodies were closely associated with the main clinical, histopathological and immunological features of primary Sjogren's syndrome. PMID: 22704838
- analysis of a novel role for tyrosine phosphorylation in regulating the interaction with IRF3 and the activity of TRIM21 downstream of TLR3 and TLR4 PMID: 22479513
- The direct interaction between TRIM21 and neutralizing antibody is essential, as single-point mutations within the TRIM21-binding site in the Fc region of a potently neutralizing antibody impair virus neutralization. PMID: 22647693
- data suggest that Ro52/SSA is involved in death receptor-mediated apoptosis by regulating c-FLIP(L) PMID: 22288650
- These findings shed light on a new physiological role for Ro52 that is important to intracellular immunity. PMID: 22178074
- anti-Ro52 autoantibodies binding the RING domain of Ro52 may be actively involved in the pathogenesis of rheumatic autoimmune disease by inhibiting Ro52-mediated ubiquitination. PMID: 21862588
- FADD and TRIM21 together negatively regulate the late IFN-alpha pathway in response to viral infection. PMID: 21183682
- 60 kD Ro and nRNP A frequently initiate human lupus autoimmunity PMID: 20224770
- Cells possess a cytosolic IgG receptor, tripartite motif-containing 21 (TRIM21), which binds to antibodies with a higher affinity than any other IgG receptor in the human body. PMID: 21045130
- Results suggest that Ro52-mediated ubiquitination promotes the degradation of IRF7 following TLR7 and TLR9 stimulation. PMID: 20668674
- Ro52-mediated monoubiquitination is involved in the subcellular translocation of active IKK beta to autophagosomes. PMID: 20627395
- Importantly, the Ro52 cytoplasmic bodies are highly motile and are located along the microtubule network. These results suggest that the Ro52 cytoplasmic bodies are unidentified structures that are transported along the microtubule network. PMID: 20013343
- Ro52 down-regulates Tax-induced NF-kappaB signalling by monoubiquitinating IKKbeta and by reducing the level of Tax PMID: 19675099