Recombinant Human TREM1 Protein

Beta LifeScience SKU/CAT #: BLA-9177P
Recombinant Human TREM1 Protein

Recombinant Human TREM1 Protein

Beta LifeScience SKU/CAT #: BLA-9177P
Catalog No.: BLA-9177P

Product Overview

Host Species Human
Accession Q9NP99
Synonym CD354 OTTMUSP00000018206 TREM 1 TREM-1 TREM1 TREM1_HUMAN Triggering receptor expressed on monocytes 1 Triggering receptor expressed on myeloid cells 1 Triggering receptor TREM 1 Triggering receptor TREM1
Description Recombinant Human TREM1 Protein was expressed in HEK293. It is a Full length protein
Source HEK293
AA Sequence ATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKTLACT ERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPK EPHMLFDRIRLVVTKGFSGTPGSNENSTQNVYKIPPTTTKALCPLYTSPR TVTQAPPKSTADVSTPDSEINLTNVTDIIRVDHHHHHH
Molecular Weight 20 kDa
Purity Greater than 95% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycle.
Recently viewed