Recombinant Human TREM1 Protein
Beta LifeScience
SKU/CAT #: BLA-9177P
Recombinant Human TREM1 Protein
Beta LifeScience
SKU/CAT #: BLA-9177P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q9NP99 |
Synonym | CD354 OTTMUSP00000018206 TREM 1 TREM-1 TREM1 TREM1_HUMAN Triggering receptor expressed on monocytes 1 Triggering receptor expressed on myeloid cells 1 Triggering receptor TREM 1 Triggering receptor TREM1 |
Description | Recombinant Human TREM1 Protein was expressed in HEK293. It is a Full length protein |
Source | HEK293 |
AA Sequence | ATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKTLACT ERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPK EPHMLFDRIRLVVTKGFSGTPGSNENSTQNVYKIPPTTTKALCPLYTSPR TVTQAPPKSTADVSTPDSEINLTNVTDIIRVDHHHHHH |
Molecular Weight | 20 kDa |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycle. |