Recombinant Human Topoisomerase II alpha Protein

Beta LifeScience SKU/CAT #: BLA-9103P
Recombinant Human Topoisomerase II alpha Protein

Recombinant Human Topoisomerase II alpha Protein

Beta LifeScience SKU/CAT #: BLA-9103P
Catalog No.: BLA-9103P

Product Overview

Host Species Human
Synonym alpha isozyme ATP hydrolyzing DNA topoisomerase II alfa DNA gyrase DNA topoisomerase (ATP hydrolyzing) DNA topoisomerase 2 alpha DNA topoisomerase 2-alpha DNA topoisomerase II DNA topoisomerase II 170 kD DNA topoisomerase II alpha isozyme DNA Topoisomerase2 TOP 2A TOP2 TOP2A TOP2A_HUMAN Topoisomerase DNA II alpha 170kDa TP2A
Description Recombinant Human Topoisomerase II alpha Protein was expressed in Wheat germ. It is a Protein fragment
Source Wheat germ
AA Sequence RAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSK AVTSKKSKGESDDFHMDFDSAVAPRAKSVRAKKPIKYLEESDEDDLF
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed