Recombinant Human Topoisomerase II alpha Protein
Beta LifeScience
SKU/CAT #: BLA-9103P
Recombinant Human Topoisomerase II alpha Protein
Beta LifeScience
SKU/CAT #: BLA-9103P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | alpha isozyme ATP hydrolyzing DNA topoisomerase II alfa DNA gyrase DNA topoisomerase (ATP hydrolyzing) DNA topoisomerase 2 alpha DNA topoisomerase 2-alpha DNA topoisomerase II DNA topoisomerase II 170 kD DNA topoisomerase II alpha isozyme DNA Topoisomerase2 TOP 2A TOP2 TOP2A TOP2A_HUMAN Topoisomerase DNA II alpha 170kDa TP2A |
Description | Recombinant Human Topoisomerase II alpha Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | RAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSK AVTSKKSKGESDDFHMDFDSAVAPRAKSVRAKKPIKYLEESDEDDLF |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |