Recombinant Human Tissue Factor Protein

Beta LifeScience SKU/CAT #: BLA-9035P
Recombinant Human Tissue Factor Protein

Recombinant Human Tissue Factor Protein

Beta LifeScience SKU/CAT #: BLA-9035P
Catalog No.: BLA-9035P

Product Overview

Host Species Human
Accession P13726
Synonym CD142 CD142 antigen Coagulation factor III Coagulation factor III (thromboplastin tissue factor) F3 FLJ17960 TF TF_HUMAN TFA Thromboplastin Tissue factor
Description Recombinant Human Tissue Factor Protein was expressed in E.coli. It is a Protein fragment
Source E.coli
AA Sequence MASMTGGQQMGRGHHHHHHGNLYFQGGEFGTTNTVAAYNLTWKSTNFKTI LEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYL ARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTK VNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNT NEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE
Molecular Weight 28 kDa including tags
Purity >90% SDS-PAGE.The final product was refolded using our unique -€œtemperature shift inclusion body refolding-€ technology and chromatographically purified.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed