Recombinant Human Thymic Stromal Lymphopoietin (TSLP) Protein (His-SUMO)

Name: Recombinant Human Thymic Stromal Lymphopoietin (TSLP) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-04092P

Greater than 90% as determined by SDS-PAGE.

Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Buy cytokines, chemokines, and growth factors for research online, Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Thymic Stromal Lymphopoietin (TSLP) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q969D9
Target Symbol	TSLP
Synonyms	Thymic stromal lymphopoietin; Thymic stromal lymphopoietin protein TSLP; Tslp; TSLP protein; TSLP_HUMAN
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Expression Range	29-159aa
Protein Length	Full Length of Mature Protein
Mol. Weight	30.9kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Cytokine that induces the release of T-cell-attracting chemokines from monocytes and, in particular, enhances the maturation of CD11c(+) dendritic cells. Can induce allergic inflammation by directly activating mast cells.; May act as an antimicrobial peptide in the oral cavity and on the skin.
Subcellular Location	Secreted.
Database References	HGNC: 30743 OMIM: 607003 KEGG: hsa:85480 STRING: 9606.ENSP00000339804 UniGene: PMID: 28368013 Effects of Linalyl Acetate on Thymic Stromal Lymphopoietin Production in Mast Cells. PMID: 30011850 presence of epithelium-derived TSLP in the eustachian tubes plays important role in the onset of eosinophilic otitis media PMID: 29272985 a new mechanism of T cell stimulation in human skin was identified, demonstrating the direct induction of T cell migration by TSLP in the absence of DCs. PMID: 28377574 the secretion of TSLP by keratinocytes is induced by the HIV-1 viral synapse in a miR-375 controlled manner PMID: 28443609 production increased at skin sites of ovalbumin sensitization PMID: 27992078 Sera of patients with infantile eosinophilic gastroenteritis showed a specific increase in both thymic stromal lymphopoietin and IL-33 levels. PMID: 26948075 short and long thymic stromal lymphopoietin isoforms have roles in house dust mite-induced asthmatic airway epithelial barrier disruption PMID: 27996052 DeltaNp73 was abundantly expressed in the atopic dermatitis epidermis and increased the release of TSLP via NF-kappaB activation. PMID: 28655470 this study shows that long form of thymic stromal lymphopoietin of keratinocytes is induced by protein allergens PMID: 28720058 we found that activation of the protease-activated receptor 1 (PAR1) induced secretion of TSLP by the corneal stromal cells... we proposed that TSLP might function as the link between increased protease activity and inflammatory responses or itch sensation in the corneas PMID: 28631887 TSLP-HOTAIR axis also plays a protective role in low-density lipoprotein (ox-LDL)-induced Endothelial cells' injury. PMID: 28615347 The aim of this study was to determine the influence of human rhinovirus on the genes involved in airway remodeling and to examine the impact of TSLP and contribution of oxidative stress on airway remodeling in the context of HRV infection. PMID: 28545810 TSLP-induced phosphorylation of l-plastin is increased in atopic dermatitis and increases eosinophil migration. PMID: 27304220 a hit expansion exercise yielded additional active compounds that could be amenable to further optimization, providing an opportunity to dissociate TSLP inhibition from other non-desired activities. This study illustrates the potential of phenotypic drug discovery to complement target based approaches by providing new chemistry and biology leads PMID: 29320511 study found that among patients with atopic dermatitis (AD), common FLG null mutations are associated with earlier AD onset in a dose-dependent manner, whereas TSLP rs1898671 appears unrelated to the timing of AD onset PMID: 28479194 lactobacilli from the omnivorous group and all bifidobacteria significantly down-regulated IL-8. Notably, both genera also lowered the TSLP expression in stimulated Caco-2 cells, regardless of the diet regimen. PMID: 27863334 this review focuses on recent advances on the effects of TSLP on obstetrical and gynecological diseases, including pregnancy failure, endometriosis, and cervical cancer PMID: 27976427 The increase in TSLP and TNF-alpha level observed in IS fluid was found to correlate with disease severity. The increased TSLP production from asthma sputum cells was abrogated by the addition of rIL-37. Regulation of TSLP pathway may be a therapeutic approach for asthma. PMID: 27528425 House dust mite sublingual immunotherapy downregulated Th2-type immune responses mediated by the TSLP-OX40L signaling pathway in patients with persistent moderate to severe allergic rhinitis. PMID: 27012942 The results suggest that IL-1beta may be an early key mediator for the acquisition of an Atopic dermatitis (AD) phenotype through induction of thymic stromal lymphopoietin (TSLP) and alteration of the epidermal homeostasis. PMID: 28191908 House dust mite exposure increases the expression of TSLP through PI3K/Akt signaling pathway in human bronchial epithelial 16HBE cells. PMID: 28400057 Posttranslational modifications control the functional activity of TSLP in humans and overproduction of TSLP may be a key trigger for the amplification of type 2 inflammation in diseases PMID: 27744031 Study provides evidence for the hypothesis that TSLP could reflect the histological severity of lumbar disc degeneration (LDD), and TSLP-siRNA and TSLPR-siRNA could inhibit apoptosis of nucleus pulposus cells. The evident information obtained from the investigation could lead the way for new therapeutic approaches regarding LDD treatment. PMID: 28746197 periostin-mediated TSLP production by keratinocytes directly stimulates cutaneous T-cell lymphoma (CTCL) tumor cell growth in addition to inducing a Th2-dominant tumor environment in CTCL. PMID: 27634769 this study shows that TSLP may be involved in the pathogenesis of asthma and rhinitis; dust mite and mugwort allergy could increase it significantly PMID: 28303765 Serum TSLP levels were significantly increased in systemic sclerosis patients compared to healthy donors, and were associated with a higher frequency of vasculopathy. The proportion of TSLP-positive dermal cells was increased in the skin of SSc patients compared with healthy donors, and was correlated with fibrosis. PMID: 27429171 this study shows that NOD2 is an asthma-related factor that can promote cell proliferation and inflammatory response by mediated expression of TSLP in human airway smooth muscle cells PMID: 27889082 the effects of TSLP on myeloid cells are crucial in reducing the multiple organ failure that is associated with systemic inflammation. PMID: 26934097 interactions between TSLP in follicular dendritic cells and IgA production in tonsils may be an important mechanism contributing to the pathogenesis of Immunoglobulin A (IgA) nephropathy. PMID: 27187742 Study demonstrated that naturally occurring severe infections by the most common respiratory viruses in hospitalized infants induce nasal airway secretion of TSLP, IL-33, and periostin when compared with healthy controls PMID: 28471975 Variations in FLG and TSLP genotype were associated with differences in self-reported skin clearance, TCI usage, and steroid usage. PMID: 27902816 A possible role of TSLP in immune homeostasis in HIV infection:higher plasma TSLP was found in individuals with primary HIV infection compared to both chronic HIV infection and healthy controls. PMID: 27769179 The polymorphism was further reproducibly associated with a DNA methylation signature in whole blood (P = 4.5x10-40) that also associated with allergic sensitization and expression in blood of the cytokine TSLP (P = 1.1x10-4). Knockdown of the transcription factor predicted to bind the enhancer region (NHLH1) in a human cell line (HEK293) expressing NHLH1 resulted in lower TSLP expression PMID: 27149122 TSLP level was significantly higher in asthmatic than in nonasthmatic children. TSLP level was significantly different between allergic asthmatic and nonallergic nonasthmatic groups. PMID: 26999524 While serum TSLP levels were unaffected by concomitant allergies and atopic comorbidities, serum levels of IL-31, IL-33 and sST2 were affected to a small extent. We found a positive correlation between TSLP, IL-31 and IL-33, and an inverse relationship between IL-33 and sST2 PMID: 27152943 Results showed that TSLP promoted the production of alpha-SMA and collagen I (P<0.001), suggesting that it can accelerate MRC-5 cell fibrosis. PMID: 27385084 TSLP is a key mediator in the pathogenesis of inflammatory bowel diseases and that further studies are needed to evaluate its role. [review] PMID: 27697608 Letter: report decreased salivary gland TSLP expression in primary Sjogren's syndrome. PMID: 27494755 A novel mouse xenograft model to study the role of TSLP-induced CRLF2 signals in normal and malignant human B lymphopoiesis has been developed. PMID: 26611474 Heat stress-induced HSPs can significantly reduce the production and secretion of TSLP from keratinocytes cultured under Th2 environment. PMID: 26419317 TSLP expression in the skin is mediated via RARgamma-RXR pathways. PMID: 26531761 Epidermal thymic stromal lymphopoietin predicts the development of atopic dermatitis during infancy. PMID: 26879860 study shows that specific food antigens can trigger innate immune mediated esophageal TSLP secretion PMID: 26992000 production by monocyte-derived dendritic cells requires the integration of signals from dectin-1, the IL-1 receptor, and endoplasmic reticulum stress response stress signaling pathways PMID: 26573878 The association of TSLP polymorphism rs2289278 with atopic dermatitis (AD) was stronger in children with allergic sensitization than in children without atopy, and TSLP polymorphisms also increased the risk of asthma in children with AD PMID: 26712523 The positive feedback loop between TSLP, IL-33 and their receptors, and Th2 cytokines may facilitate Th2-skewed inflammation in eosinophilic CRSwNP. PMID: 26095319 results show that rs1837253 polymorphism may be directly involved in the regulation of TSLP secretion. PMID: 25515628 Upon TSLP stimulation, the cells with the highest TSLPR expression level showed enhanced proliferation and JAK/STAT-mediated gene regulation in a dose-dependent manner PMID: 26652578 Thymic stromal lymphopoietin activation of basophils in patients with allergic asthma is IL-3 dependent PMID: 25962901

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Thymic Stromal Lymphopoietin (TSLP) Protein (His-SUMO)

Product Overview

Target Details

FAQs