Recombinant Human TEM7 Protein

Beta LifeScience SKU/CAT #: BLA-8888P
Recombinant Human TEM7 Protein

Recombinant Human TEM7 Protein

Beta LifeScience SKU/CAT #: BLA-8888P
Catalog No.: BLA-8888P

Product Overview

Host Species Human
Accession Q8IUK5
Synonym DKFZp686F0937 FLJ36270 FLJ45632 OTTHUMP00000164240 Plexin domain containing 1 Plexin domain containing protein 1 precursor Plexin domain-containing protein 1 Plxdc1 PXDC1_HUMAN TEM3 TEM7 Tumor endothelial marker 3 Tumor endothelial marker 7
Description Recombinant Human TEM7 Protein was expressed in HEK293. It is a Protein fragment
Source HEK293
AA Sequence LSPQPGAGHDEGPGSGWAAKGTVRGWNRRARESPGHVSEPDRTQLSQDLG GGTLAMDTLPDNRTRVVEDNHSYYVSRLYGPSEPHSRELWVDVAEANRSQ VKIHTILSNTHRQASRVVLSFDFPFYGHPLRQITMATGGFIFMGDVIHRM LTATQYVAPLMANFNPGYSDNSTVVYFDNGTVFVVQWDHVYLQGWEDKGS FTFQAALHHDGRIVFAYKEIPMSVPEISSSQHPVKTGLSDAFMILNPSPD VPESRRRSIFEYHRIELDPSKVTSMSAVEFTPLPTCLQHRSCDACMSSDL TFNCSWCHVLQRCSSGFDRYRQEWMDYGCAQEAEGRMCEDFQDEDHDSAS PDTSFSPYDGDLTTTSSSLFIDSLTTEDDTKLNPYAGGDGLQNNLSPKTK GTPVHLGTVDHHHHHH
Molecular Weight 47 kDa including tags
Purity >95% SDS-PAGE.Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -80°C.
Recently viewed