Recombinant Human Tef Protein
Beta LifeScience
SKU/CAT #: BLA-8884P
Recombinant Human Tef Protein
Beta LifeScience
SKU/CAT #: BLA-8884P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q10587 |
Synonym | 2310028D20Rik fb11h02 MGC64507 Tef TEF_HUMAN tefa tefb tefbeta Thyrotroph embryonic factor VBP Vitellogenin gene binding protein wu:fa12f02 wu:fb11h02 zTEF[a] |
Description | Recombinant Human Tef Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSMSDAGGGKKPPVDPQAGPGPGPGRAAG ERGLSGSFPLVLKKLMENPPREARLDKEKGKEKLEEDEAAAASTMAVSAS LMPPIWDKTIPYDGESFHLEYMDLDEFLLENGIPASPTHLAHNLLLPVAE LEGKESASSSTASPPSSSTAIFQPSETVSSTESSLEKERETPSPIDPNCV EVDVNFNPDPADLVLSSVPGGELFNPRKHKFAEEDLKPQPMIKKAKKVFV PDEQKDEKYWTRRKKNNVAAKRSRDARRLKENQITIRAAFLEKENTALRT EVAELRKEVGKCKTIVSKYETKYGPL |
Molecular Weight | 36 kDa including tags |
Purity | Greater than 85% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |