Recombinant Human Tef Protein

Beta LifeScience SKU/CAT #: BLA-8884P
Recombinant Human Tef Protein

Recombinant Human Tef Protein

Beta LifeScience SKU/CAT #: BLA-8884P
Catalog No.: BLA-8884P

Product Overview

Host Species Human
Accession Q10587
Synonym 2310028D20Rik fb11h02 MGC64507 Tef TEF_HUMAN tefa tefb tefbeta Thyrotroph embryonic factor VBP Vitellogenin gene binding protein wu:fa12f02 wu:fb11h02 zTEF[a]
Description Recombinant Human Tef Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMGSMSDAGGGKKPPVDPQAGPGPGPGRAAG ERGLSGSFPLVLKKLMENPPREARLDKEKGKEKLEEDEAAAASTMAVSAS LMPPIWDKTIPYDGESFHLEYMDLDEFLLENGIPASPTHLAHNLLLPVAE LEGKESASSSTASPPSSSTAIFQPSETVSSTESSLEKERETPSPIDPNCV EVDVNFNPDPADLVLSSVPGGELFNPRKHKFAEEDLKPQPMIKKAKKVFV PDEQKDEKYWTRRKKNNVAAKRSRDARRLKENQITIRAAFLEKENTALRT EVAELRKEVGKCKTIVSKYETKYGPL
Molecular Weight 36 kDa including tags
Purity Greater than 85% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed