Recombinant Human TDG Protein

Beta LifeScience SKU/CAT #: BLA-8865P
Recombinant Human TDG Protein

Recombinant Human TDG Protein

Beta LifeScience SKU/CAT #: BLA-8865P
Catalog No.: BLA-8865P

Product Overview

Host Species Human
Accession Q13569
Synonym C JUN leucine zipper interactive protein C-JUN leucine zipper interactive protein JZA-3 E130317C12Rik EC 3.2.2.29 G/T mismatch specific thymine DNA glycosylase G/T mismatch-specific thymine DNA glycosylase JZA 3 Jza1 T:G mismatch thymine glycosylase Tdg TDG_HUMAN Thymine DNA glycosylase Thymine-DNA glycosylase
Description Recombinant Human TDG Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MEAENAGSYSLQQAQAFYTFPFQQLMAEAPNMAVVNEQQMPEEVPAPAPA QEPVQEAPKGRKRKPRTTEPKQPVEPKKPVESKKSGKSAKSKEKQEKITD TFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGH HYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGS KDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNL EFGLQPHKIPDTETLCYGMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLK GIERNMDVQEVQYTFDLQLAQEDAKKMAVKEEKYDPGYEAAYGGAYGENP CSSEPCGFSSNGLIESVELRGESAFSGIPNGQWMTQSFTDQIPSFSNHCG TQEQEEESHA
Molecular Weight 71 kDa including tags
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed