Recombinant Human SUPT16H Protein

Beta LifeScience SKU/CAT #: BLA-8632P
Recombinant Human SUPT16H Protein

Recombinant Human SUPT16H Protein

Beta LifeScience SKU/CAT #: BLA-8632P
Catalog No.: BLA-8632P

Product Overview

Host Species Human
Synonym CDC68 Chromatin specific transcription elongation factor 140 kDa subunit Chromatin-specific transcription elongation factor 140 kDa subunit Facilitates chromatin transcription complex subunit SPT16 FACT FACT 140 kDa subunit FACT complex subunit SPT16 FACTp140 FLJ10857 FLJ14010 hSPT16 SP16H_HUMAN Suppressor of Ty 16 homolog Supt16h
Description Recombinant Human SUPT16H Protein was expressed in Wheat germ. It is a Protein fragment
Source Wheat germ
AA Sequence PGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNR SNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHA LFQPCDGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed