Recombinant Human SUPT16H Protein
Beta LifeScience
SKU/CAT #: BLA-8632P
Recombinant Human SUPT16H Protein
Beta LifeScience
SKU/CAT #: BLA-8632P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | CDC68 Chromatin specific transcription elongation factor 140 kDa subunit Chromatin-specific transcription elongation factor 140 kDa subunit Facilitates chromatin transcription complex subunit SPT16 FACT FACT 140 kDa subunit FACT complex subunit SPT16 FACTp140 FLJ10857 FLJ14010 hSPT16 SP16H_HUMAN Suppressor of Ty 16 homolog Supt16h |
Description | Recombinant Human SUPT16H Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | PGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNR SNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHA LFQPCDGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |