Recombinant Human SUN2 Protein

Beta LifeScience SKU/CAT #: BLA-8620P
Recombinant Human SUN2 Protein

Recombinant Human SUN2 Protein

Beta LifeScience SKU/CAT #: BLA-8620P
Catalog No.: BLA-8620P

Product Overview

Host Species Human
Accession Q9UH99
Synonym FRIGG KIAA0668 nuclear envelope protein Protein unc-84 homolog B Rab5 interacting protein RAB5IP Sad1 and UNC84 domain containing 2 Sad1 unc-84 domain protein 2 Sad1 unc84 domain protein Sad1/unc-84 protein-like 2 Sad1/unc84 protein-like SUN domain-containing protein 2 UNC 84B unc84 homolog B unc84 homolog B (C. elegans) unc84, C. elegans, homolog of, B UNC84B
Description Recombinant Human SUN2 Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MSRRSQRLTRYSQGDDDGSSSSGGSSVAGSQSTLFKDSPLRTLKRKSSNM KRLSPAPQLGPSSDAHTSYYSESLVHESWFPPRSSLEELHGDANWGEDLR VRRRRGTGGSESSRASGLVGRKATEDFLGSSSGYSSEDDYVGYSDVDQQS SSSRLRSAVSRAGSLLWMVATSPGRLFRLLYWWAGTTWYRLTTAASLLDV FVLTRRFSSLKTFLWFLLPLLLLTCLTYGAWYFYPYGLQTFHPALVSWWA AKDSRRPDEGWEARDSSPHFQAEQRVMSRVHSLERRLEALAAEFSSNWQK EAMRLERLELRQGAPGQGGGGGLSHEDTLALLEGLVSRREAALKEDFRRE TAARIQEELSALRAEHQQDSEDLFKKIVRASQESEARIQQLKSEWQSMTQ ESFQESSVKELRRLEDQLAGLQQELAALALKQSSVAEEVGLLPQQIQAVR DDVESQFPAWISQFLARGGGGRVGLLQREEMQAQLRELESKILTHVAEMQ GKSAREAAASLSLTLQKEGVIGVTEEQVHHIVKQALQRYSEDRIGLADYA LESGGASVISTRCSETYETKTALLSLFGIPLWYHSQSPRVILQPDVHPGN CWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFAIFG FDEDLQQEGTLLGKFTYDQDGEPIQTFHFQAPTMATYQVVELRILTNWGH PEYTCIYRFRVHGEPAH
Molecular Weight 105 kDa including tags
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed