Recombinant Human ST2 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-8494P
Recombinant Human ST2 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-8494P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q01638-2 |
Synonym | DER-4 DER4 FIT 1 Growth stimulation expressed homolog of mouse growth stimulation-expressed Il1rl1 IL33R ILRL1_HUMAN Interleukin 1 receptor like 1 interleukin 1 receptor related protein Interleukin-1 receptor-like 1 Protein ST2 ST2 ST2L ST2V T1 T1 protein |
Description | Recombinant Human ST2 Protein (His tag) was expressed in HEK293. It is a Full length protein |
Source | HEK293 |
AA Sequence | KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFAS GQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLM YSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVI DNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPA QNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQ EEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRL SRKNPSKECF |
Molecular Weight | 36 kDa including tags |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -20°C or -80°C. Avoid freeze / thaw cycle. |