Recombinant Human ST2 Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-8494P
Recombinant Human ST2 Protein (His tag)

Recombinant Human ST2 Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-8494P
Catalog No.: BLA-8494P

Product Overview

Host Species Human
Accession Q01638-2
Synonym DER-4 DER4 FIT 1 Growth stimulation expressed homolog of mouse growth stimulation-expressed Il1rl1 IL33R ILRL1_HUMAN Interleukin 1 receptor like 1 interleukin 1 receptor related protein Interleukin-1 receptor-like 1 Protein ST2 ST2 ST2L ST2V T1 T1 protein
Description Recombinant Human ST2 Protein (His tag) was expressed in HEK293. It is a Full length protein
Source HEK293
AA Sequence KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFAS GQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLM YSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVI DNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPA QNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQ EEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRL SRKNPSKECF
Molecular Weight 36 kDa including tags
Purity >95% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed