Recombinant Human SEMA6D Protein
Beta LifeScience
SKU/CAT #: BLA-8082P
Recombinant Human SEMA6D Protein
Beta LifeScience
SKU/CAT #: BLA-8082P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Synonym | KIAA1479 Q8NFY4 Sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6D Semaphorin 6D |
Description | Recombinant Human SEMA6D Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | KLQNIDHPLTKSSSKRDHRRSVDSRNTLNDLLKHLNDPNSNPKAIMGDIQ MAHQNLMLDPMGSMSEVPPKVPNREASLYSPPSTLPRNS |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |