Recombinant Human SECTM1 Protein
Beta LifeScience
SKU/CAT #: BLA-8067P
Recombinant Human SECTM1 Protein
Beta LifeScience
SKU/CAT #: BLA-8067P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q8WVN6 |
Synonym | K12 K12 protein Protein K-12 Protein K12 SCTM1_HUMAN Secreted and transmembrane 1 Secreted and transmembrane protein 1 SECTM 1 SECTM1 Type 1a transmembrane protein |
Description | Recombinant Human SECTM1 Protein was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIF NEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNN RQVTLEVSGAEPQSAPDTG |
Molecular Weight | 14 kDa including tags |
Purity | >92% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | May be involved in thymocyte signaling. |
Subcellular Location | Cell membrane; Single-pass type I membrane protein. Secreted. |
Protein Families | SECTM family |
Database References | |
Tissue Specificity | Detected at the highest levels in peripheral blood leukocytes and breast cancer cell lines. Found in leukocytes of the myeloid lineage, with the strongest expression observed in granulocytes and no detectable expression in lymphocytes. Expressed in thymic |
Gene Functions References
- CD7 is present on monocytes and tumor macrophages and its ligand, SECTM1, is frequently expressed in corresponding melanoma tissues PMID: 24157461
- SECTM1 secreted from bone marrow stromal cells may interact with CD7 to influence GM-CSF expression in leukemic cells. PMID: 24211252
- level of SECTM1 expression is likely to be a key factor in innate immune responses and in the immune tolerance of cancerous cells PMID: 21749909