Recombinant Human SECTM1 Protein
Beta LifeScience
SKU/CAT #: BLA-8067P
Recombinant Human SECTM1 Protein
Beta LifeScience
SKU/CAT #: BLA-8067P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q8WVN6 |
Synonym | K12 K12 protein Protein K-12 Protein K12 SCTM1_HUMAN Secreted and transmembrane 1 Secreted and transmembrane protein 1 SECTM 1 SECTM1 Type 1a transmembrane protein |
Description | Recombinant Human SECTM1 Protein was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIF NEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNN RQVTLEVSGAEPQSAPDTG |
Molecular Weight | 14 kDa including tags |
Purity | >92% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle. |