Recombinant Human SEC22C Protein
Beta LifeScience
SKU/CAT #: BLA-8058P
Recombinant Human SEC22C Protein
Beta LifeScience
SKU/CAT #: BLA-8058P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | DKFZp761F2321 MGC13261 MGC5373 OTTHUMP00000162608 SEC22 homolog C, vesicle trafficking protein SEC22 vesicle trafficking protein homolog C SEC22 vesicle trafficking protein homolog C (S. cerevisiae) SEC22 vesicle trafficking protein like 3 SEC22 vesicle trafficking protein like 3 (S. cerevisiae) SEC22 vesicle trafficking protein like protein C SEC22L3 secretion deficient 22C vesicle trafficking protein Vesicle trafficking protein SEC22c |
Description | Recombinant Human SEC22C Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MSVIFFACVVRVRDGLPLSASTDFYHTQDFLEWRRRLKSLALRLAQYPGR GSAEGCDFSIHFSSFGDVACMAICSCQCPAAMAFCFLETLWWEFTASYDT TCIGLASRPYAFLEFDSIIQKVKWHFNYVSSSQMECSLEKIQEELKLQPP AVLTLEDTDVANGVMNGHTPMHLEPAPNFRMEPVTALGILSLILNIMCAA LNLIRGVHLAEHSLQVAHEEIGNILAFLVPFVACIFQCYLYLFYSPARTM KVVLMLLFICLGNMYLHGLRNLWQILFHIGVAFLSSYQILTRQLQEKQSD CGV |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |