Recombinant Human Sclerostin Protein
Beta LifeScience
SKU/CAT #: BLA-8031P
Recombinant Human Sclerostin Protein
Beta LifeScience
SKU/CAT #: BLA-8031P
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q9BQB4 |
Synonym | BEER CDD Cortical hyperostosis with syndactyly Sclerosteosis Sclerostin Sost SOST_HUMAN SOST1 UNQ2976/PRO7455/PRO7476 VBCH |
Description | Recombinant Human Sclerostin Protein was expressed in CHO cells. It is a Full length protein |
Source | CHO cells |
AA Sequence | QGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETK DVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGK WWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRF HNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY |
Molecular Weight | 22 kDa |
Purity | >= 95% SDS-PAGE.>= 95% by HPLC analysis. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Determined by its ability to downregulate alkaline phosphatase activity in differentiating MC3T3-E1 cells in the presence of 20ng/ml murine Wnt-3a. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |