Recombinant Human Sclerostin Protein
Beta LifeScience
SKU/CAT #: BLA-8029P
Recombinant Human Sclerostin Protein
Beta LifeScience
SKU/CAT #: BLA-8029P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q9BQB4 |
Synonym | BEER CDD Cortical hyperostosis with syndactyly Sclerosteosis Sclerostin Sost SOST_HUMAN SOST1 UNQ2976/PRO7455/PRO7476 VBCH |
Description | Recombinant Human Sclerostin Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | QGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETK DVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGK WWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRF HNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY |
Molecular Weight | 23 kDa including tags |
Purity | Greater than 90% Densitometry. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at Room Temperature. Store at +4°C short term (1-2 weeks). Store at -80°C. Avoid freeze / thaw cycle. |