Recombinant Human Sclerostin Protein
Beta LifeScience
SKU/CAT #: BLA-8029P
Recombinant Human Sclerostin Protein
Beta LifeScience
SKU/CAT #: BLA-8029P
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q9BQB4 |
Synonym | BEER CDD Cortical hyperostosis with syndactyly Sclerosteosis Sclerostin Sost SOST_HUMAN SOST1 UNQ2976/PRO7455/PRO7476 VBCH |
Description | Recombinant Human Sclerostin Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | QGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETK DVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGK WWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRF HNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY |
Molecular Weight | 23 kDa including tags |
Purity | Greater than 90% Densitometry. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at Room Temperature. Store at +4°C short term (1-2 weeks). Store at -80°C. Avoid freeze / thaw cycle. |