Recombinant Human SCGN/Secretagogin Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-8028P
Recombinant Human SCGN/Secretagogin Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-8028P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | O76038 |
Synonym | Calbindin like CALBL DJ501N12.8 OTTHUMP00000016124 Scgn SECRET Secretagogin Secretagogin EF hand calcium binding protein SEGN SEGN_HUMAN Setagin |
Description | Recombinant Human SCGN/Secretagogin Protein (His tag) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | DSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTD DTVMKANLHKVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRE NPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLHHKKAISEAKLE EYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRD FEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLR HCDVNKDGKIQKSELALCLGLKINP |
Molecular Weight | 33 kDa including tags |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |