Recombinant Human Salivary alpha amylase Protein
Beta LifeScience
SKU/CAT #: BLA-7997P
Recombinant Human Salivary alpha amylase Protein
Beta LifeScience
SKU/CAT #: BLA-7997P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | amylase, salivary, B 1 1 4 alpha D glucan glucanohydrolase 1,4 alpha D glucan glucanohydrolase 2B 1,4-alpha-D-glucan glucanohydrolase 1 4-alpha-D-glucan glucanohydrolase 1 Alpha amylase Alpha-amylase 1 AMY1 AMY1_HUMAN AMY1C AMY2 AMY2B AMY3 amylase, alpha 1A (salivary) Amylase, alpha 1B (salivary) amylase, alpha 1C (salivary) amylase, salivary, alpha-1A amylase, salivary, alpha-1B amylase, salivary, alpha-1C amylase, salivary, C glycogenase HXA PA Salivary alpha-amylase salivary amylase alpha 1A salivary amylase alpha 1B salivary amylase alpha 1C |
Description | Recombinant Human Salivary alpha amylase Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | VRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGD IKAILDKLHNLNSNWFPEGSKPFI |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |