Recombinant Human S100 alpha 2/S100A2 Protein

Beta LifeScience SKU/CAT #: BLA-8817P
Recombinant Human S100 alpha 2/S100A2 Protein

Recombinant Human S100 alpha 2/S100A2 Protein

Beta LifeScience SKU/CAT #: BLA-8817P
Catalog No.: BLA-8817P

Product Overview

Host Species Human
Accession P29034
Synonym CAN19 MGC111539 Protein S 100L Protein S-100L Protein S100 A2 Protein S100-A2 Protein S100L S100 A2 S100 calcium binding protein A2 S100 calcium-binding protein A2 S100A2 S100L S10A2_HUMAN
Description Recombinant Human S100 alpha 2/S100A2 Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMCSSLEQALAVLVTTFHKYSCQEGDKFKLS KGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLA LITVMCNDFFQGCPDRP
Molecular Weight 13 kDa including tags
Purity Greater than 90% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle.
Recently viewed