Recombinant Human RS1 Protein
Beta LifeScience
SKU/CAT #: BLA-7943P
Recombinant Human RS1 Protein
Beta LifeScience
SKU/CAT #: BLA-7943P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | Retinoschisin RS1 X-linked juvenile retinoschisis protein XLRS1_HUMAN |
Description | Recombinant Human RS1 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MSRKIEGFLLLLLFGYEATLGLSSTEDEGEDPWYQKACKCDCQGGPNALW SAGATSLDCIPECPYHKPLGFESGEVTPDQITCSNPEQYVGWYSSWTANK ARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQGRCDIDEWMTK YSVQYRTDERLNWIYYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRFIR LIPLGWHVRIAIRMELLECVSKCA |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |