Recombinant Human RPB3 Protein
Beta LifeScience
SKU/CAT #: BLA-7881P
Recombinant Human RPB3 Protein
Beta LifeScience
SKU/CAT #: BLA-7881P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P19387 |
Synonym | DNA directed RNA polymerase II 33 kDa polypeptide DNA directed RNA polymerase II subunit C DNA directed RNA polymerase II subunit RPB3 DNA-directed RNA polymerase II 33 kDa polypeptide DNA-directed RNA polymerase II subunit C DNA-directed RNA polymerase II subunit RPB3 hRPB33 hsRPB3 POLR 2C POLR2 C Polr2c Polymerase (RNA) II (DNA directed) polypeptide C, 33kDa polymerase RNA II DNA directed polypeptide C 33kDa RNA polymerase II polypeptide C RNA polymerase II subunit 3 RNA polymerase II subunit B3 RPB 3 RPB3 RPB3_HUMAN RPB31 RPB33 |
Description | Recombinant Human RPB3 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSMPYANQPTVRITELTDENVKFIIENTD LAVANSIRRVFIAEVPIIAIDWVQIDANSSVLHDEFIAHRLGLIPLISDD IVDKLQYSRDCTCEEFCPECSVEFTLDVRCEDQTRHVTSRDLISNSRVIP VTSRNRDNDPNDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPT AGVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERF YYNVESCGSLRPETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN |
Molecular Weight | 34 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |