Recombinant Human RIDA Protein
Beta LifeScience
SKU/CAT #: BLA-7804P
Recombinant Human RIDA Protein
Beta LifeScience
SKU/CAT #: BLA-7804P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P52758 |
Synonym | 14.5 kDa translational inhibitor protein 2-iminobutanoate/2-iminopropanoate deaminase Heat responsive protein 12 Heat-responsive protein 12 Hrsp12 p14.5 Perchloric acid soluble protein PSP Reactive intermediate imine deaminase A homolog Ribonuclease UK114 RIDA Translational inhibitor p14.5 Translational inhibitor protein p14.5 UK114 UK114 antigen homolog UK114_HUMAN |
Description | Recombinant Human RIDA Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMSSLIRRVISTAKAPGAIGPYSQAVLVDRT IYISGQIGMDPSSGQLVSGGVAEEAKQALKNMGEILKAAGCDFTNVVKTT VLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSRIEIEAVAIQG PLTTASL |
Molecular Weight | 17 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle. |