Recombinant Human Rffl Protein
Beta LifeScience
SKU/CAT #: BLA-7761P
Recombinant Human Rffl Protein
Beta LifeScience
SKU/CAT #: BLA-7761P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q8WZ73 |
Synonym | CARP-2 CARP2 Caspase regulator CARP2 Caspases 8 and 10 associated RING finger protein 2 caspases-8 and -10- associated RING finger protein 2 Caspases-8 and -10-associated RING finger protein 2 E3 ubiquitin protein ligase rififylin E3 ubiquitin-protein ligase rififylin Fring FYVE RING finger protein Sakura FYVE-RING finger protein Sakura Rffl RFFL_HUMAN Rififylin RING finger and FYVE like domain containing protein RING finger and FYVE-like domain-containing protein 1 RING finger protein 189 RING finger protein 34 like RING finger protein 34-like RNF189 RNF34L |
Description | Recombinant Human Rffl Protein was expressed in Baculovirus infected Sf9 cells. It is a Full length protein |
Source | Baculovirus infected Sf9 cells |
AA Sequence | MWATCCNWFCLDGQPEEVPPPQGARMQAYSNPGYSSFPSPTGLEPSCKSC GAHFANTARKQTCLDCKKNFCMTCSSQVGNGPRLCLLCQRFRATAFQREE LMKMKVKDLRDYLSLHDISTEMCREKEELVLLVLGQQPVISQEDRTRAST LSPDFPEQQAFLTQPHSSMVPPTSPNLPSSSAQATSVPPAQVQENQQANG HVSQDQEEPVYLESVARVPAEDETQSIDSEDSFVPGRRASLSDLTDLEDI EGLTVRQLKEILARNFVNYKGCCEKWELMERVTRLYKDQKGLQHLVSGAE DQNGGAVPSGLEENLCKICMDSPIDCVLLECGHMVTCTKCGKRMNECPIC RQYVIRAVHVFRS |
Purity | >70% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | The specific activity ofthis protein was18 nmol/min/mg in aubiquitinating assay usingwild-type ubiquitin protein as substrate. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |