Recombinant Human RELM beta Protein
Beta LifeScience
SKU/CAT #: BLA-7703P
Recombinant Human RELM beta Protein
Beta LifeScience
SKU/CAT #: BLA-7703P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q9NSA1 |
Synonym | C/EBP epsilon regulated myeloid specific secreted cysteine rich protein precursor 2 CCGR Colon and small intestine specific cysteine rich protein Colon and small intestine-specific cysteine-rich protein Colon carcinoma related gene protein Colon carcinoma-related gene protein Cysteine rich secreted A12 alpha like protein 1 Cysteine rich secreted protein A12 alpha like 1 Cysteine rich secreted protein FIZZ2 Cysteine-rich secreted protein A12-alpha-like 1 Cysteine-rich secreted protein FIZZ2 FIZZ1 FIZZ2 Found in inflammatory zone 1 HXCP2 RELM beta RELMb RELMbeta Resistin like beta Resistin like protein beta Resistin-like beta RETNB_HUMAN RETNL2 Retnlb XCP2 |
Description | Recombinant Human RELM beta Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSP ESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELL LEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEP PGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS |
Molecular Weight | 12 kDa |
Purity | >95% by SDS-PAGE . |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at Room Temperature. Upon delivery aliquot. Store at -20°C or -80°C. Working aliquots stored with a carrier protein are stable for at least 3 months at -20°C to -80°C.. |