Recombinant Human RCE1 Protein (N-10xHis)
Beta LifeScience
SKU/CAT #: BLC-11414P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human RCE1 Protein (N-10xHis)
Beta LifeScience
SKU/CAT #: BLC-11414P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | Q9Y256 |
Target Symbol | RCE1 |
Species | Human |
Expression System | in vitro E.coli expression system |
Tag | N-terminal 10xHis-tagged |
Target Protein Sequence | MAALGGDGLRLLSVSRPERPPESAALGGLGPGLCCWVSVFSCLSLACSYVGSLYVWKSELPRDHPAVIKRRFTSVLVVSSLSPLCVLLWRELTGIQPGTSLLTLMGFRLEGIFPAALLPLLLTMILFLGPLMQLSMDCPCDLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCMGLGPAVFTCPLFFGVAHFHHIIEQLRFRQSSVGNIFLSAAFQFSYTAVFGAYTAFLFIRTGHLIGPVLCHSFCNYMGFPAVCAALEHPQRRPLLAGYALGVGLFLLLLQPLTDPKLYGSLPLCVLLERAGDSEAPLCS |
Expression Range | 1-329aa |
Protein Length | Full Length |
Mol. Weight | 38.7 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Function | Proteolytically removes the C-terminal three residues of farnesylated and geranylated proteins. Seems to be able to process K-Ras, N-Ras, H-Ras, RAP1B and G-gamma-1. |
Subcellular Location | Endoplasmic reticulum membrane; Multi-pass membrane protein. |
Protein Families | Peptidase U48 family |
Database References |
HGNC: 13721 OMIM: 605385 KEGG: hsa:9986 STRING: 9606.ENSP00000309163 UniGene: Hs.654972 |
Tissue Specificity | Ubiquitous. |