Recombinant Human SLC39A1 Protein (N-GST)
Beta LifeScience
SKU/CAT #: BLC-11425P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human SLC39A1 Protein (N-GST)
Beta LifeScience
SKU/CAT #: BLC-11425P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q9NY26 |
Target Symbol | SLC39A1 |
Species | Human |
Expression System | E.coli |
Tag | N-terminal GST-tagged |
Target Protein Sequence | MEQITLAYKEQSGPSPLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALR |
Expression Range | 126-179aa |
Protein Length | Cytoplasmic Domain |
Mol. Weight | 33.1kDa |
Research Area | Transport |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Function | Mediates zinc uptake. May function as a major endogenous zinc uptake transporter in many cells of the body. Responsible for the rapid uptake and accumulation of physiologically effective zinc in prostate cells. |
Subcellular Location | Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Note=Shows a vesicular localization corresponding partially to the endoplasmic reticulum in several epithelial cell lines. |
Protein Families | ZIP transporter (TC 2.A.5) family |
Database References |
HGNC: 12876 OMIM: 604740 KEGG: hsa:27173 STRING: 9606.ENSP00000309710 UniGene: Hs.743291 |
Tissue Specificity | Ubiquitous. Expressed in most adult and fetal tissues including the epidermis. |