Recombinant Human Ras-Related Protein Rab-18 (RAB18) Protein (GST)

Name: Recombinant Human Ras-Related Protein Rab-18 (RAB18) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-08690P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Ras-Related Protein Rab-18 (RAB18) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q9NP72
Target Symbol	RAB18
Synonyms	AA959686; RAB18; RAB18 small GTPase; RAB18; member RAS oncogene family; RAB18_HUMAN; RAB18LI1; Ras related protein Rab 18; Ras-asssociated protein RAB18; Ras-related protein Rab-18; RP11-148B2.1; WARBM3
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYC
Expression Range	1-206aa
Protein Length	Full Length
Mol. Weight	49.7kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Required for the localization of ZFYVE1 to lipid droplets and for its function in mediating the formation of endoplasmic reticulum-lipid droplets (ER-LD) contacts. Plays a role in apical endocytosis/recycling. Plays a key role in eye and brain development and neurodegeneration.
Subcellular Location	Apical cell membrane. Lipid droplet.
Protein Families	Small GTPase superfamily, Rab family
Database References	HGNC: 14244 OMIM: 602207 KEGG: hsa:22931 STRING: 9606.ENSP00000349415 UniGene: PMID: 28003315 findings suggest that RAB18 rs3765133 polymorphism affects the development of specific brain regions, particularly the cerebellum, in healthy people. PMID: 24996981 RAB18 is the direct target of miR-455-5p in gastric cancer. PMID: 27451075 Warburg Micro syndrome is caused by RAB18 deficiency. PMID: 26063829 These results suggest that Rab18 has an important role in viral assembly through the trafficking of the hepatitis C virus core protein to lipid droplets. PMID: 24997429 High RAB18 expression is associated with glioma. PMID: 24477653 Rab18-mediated membrane trafficking of FASN and NS3 facilitates dengue virus replication. PMID: 24696471 Rab18 interacts with the HCV nonstructural protein NS5A. PMID: 23935497 Hepatitis B virus X protein enhances proliferation of hepatoma cells through Rab18. PMID: 23471881 Micro syndrome has been associated with causative mutations in three disease genes: RAB3GAP1, RAB3GAP2 and RAB18. Martsolf syndrome has been associated with a mutation in RAB3GAP2. [Review] PMID: 23176487 performed autozygosity mapping in five consanguineous families with Warburg micro syndrome without RAB3GAP1/2 mutations and identified loss-of-function mutations in RAB18 PMID: 21473985 Rab18 regulates lipid droplet-associated membrane formation PMID: 15914536 analysis of a novel splice variant of human Rab18 gene PMID: 16147880 Rab18 is reduced in pituitary tumors causing acromegaly and its overexpression reverts growth hormone hypersecretion. PMID: 18349058 Rab18 and Rab43 have key roles in ER-Golgi trafficking. PMID: 18664496 Rab18 is recruited to lipid droplets during lipolysis PMID: 16207721

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.