Recombinant Human RanBP2 Protein
Beta LifeScience
SKU/CAT #: BLA-7633P
Recombinant Human RanBP2 Protein
Beta LifeScience
SKU/CAT #: BLA-7633P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P49792 |
Synonym | 358 kDa nucleoporin ANE1 E3 SUMO-protein ligase RanBP2 IIAE3 Nuclear pore complex protein Nup358 Nucleoporin 358 Nucleoporin Nup358 NUP358 p270 RAN binding protein 2 Ran-binding protein 2 RANBP2 RBP2_HUMAN Transformation related protein 2 TRP 1 TRP 2 TRP1 TRP2 |
Description | Recombinant Human RanBP2 Protein was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | LKSNNSETSSVAQSGSESKVEPKKCELSKNSDIEQSSDSKVKNLFASFPT EESSINYTFKTPEKAKEKKKPEDSPSDDDVLIVYELTPTAEQKALATKLK LPPTFFCYKNRPDYVSEEEEDDEDFETAVKKLNGKLYLDGSEKCRPLEEN TADNEKECIIVWEKKPTVEEKAKADTLKLPPTFFCGVCSDTDEDNGNGED FQSELQKVQEAQKSQTEEITSTTDSVYTGGTEVMVPSFCKSEEPDSITKS ISSPSVSSETMDKPVDLSTRKEIDTDSTSQGESKIV |
Purity | >75% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | The specific activity of this protein was 73 nmol/min/mg in SUMOylation assay using SUMO2 (1-93) as substrate. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |